Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP8, Human (sf9, His, GST)

USP8 is a key hydrolase in cellular regulation and plays a crucial role in protein turnover by efficiently deubiquitinating proteins and preventing degradation. Its activity spans "Lys-48" and "Lys-63" linked ubiquitin chains, highlighting its versatility. USP8 Protein, Human (sf9, His, GST) is the recombinant human-derived USP8 protein, expressed by Sf9 insect cells, with N-His and N-GST labeled tag.

Product Specifications

Product Name Alternative

USP8 Protein, Human (sf9, His, GST), Human, Sf9 insect cells

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/usp8-protein-human-sf9-his-gst.html

Smiles

PTVTPTVNRENKPTCYPKAEISRLSASQIRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTGQYRYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDHLDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNNLKKYNLFSVSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVKSSAAYILFYTSLG

Molecular Formula

9101 (Gene_ID) P40818-1 (P734-G1110) (Accession)

Molecular Weight

Approximately 70.8 kDa

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Research Grade Tebotelimab
DHD30407 100 μg

Research Grade Tebotelimab

Sign In for Pricing
View Details
QPCR Kit DNA Microsporum gypseum
MOL8820 1 Each

QPCR Kit DNA Microsporum gypseum

Sign In for Pricing
View Details
TRIM13 (Tripartite Motif-Containing 13, CAR, DLEU5, LEU5, RFP2, RNF77) (APC)
252972-APC 100 µL

TRIM13 (Tripartite Motif-Containing 13, CAR, DLEU5, LEU5, RFP2, RNF77) (APC)

Sign In for Pricing
View Details
PSCA (NM_005672) Human Tagged Lenti ORF Clone
RC209136L1 10 µg

PSCA (NM_005672) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal UBE4A Antibody [Biotin]
NBP2-98835B 0.1 mL

Rabbit Polyclonal UBE4A Antibody [Biotin]

Sign In for Pricing
View Details
PLV3-U6-Trem1-shRNA2-CopGFP-Puro Plasmid
PVT77223 2 µg

PLV3-U6-Trem1-shRNA2-CopGFP-Puro Plasmid

Sign In for Pricing
View Details