Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP8, Human (sf9, His, GST)

USP8 is a key hydrolase in cellular regulation and plays a crucial role in protein turnover by efficiently deubiquitinating proteins and preventing degradation. Its activity spans "Lys-48" and "Lys-63" linked ubiquitin chains, highlighting its versatility. USP8 Protein, Human (sf9, His, GST) is the recombinant human-derived USP8 protein, expressed by Sf9 insect cells, with N-His and N-GST labeled tag.

Product Specifications

Product Name Alternative

USP8 Protein, Human (sf9, His, GST), Human, Sf9 insect cells

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/usp8-protein-human-sf9-his-gst.html

Smiles

PTVTPTVNRENKPTCYPKAEISRLSASQIRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTGQYRYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDHLDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNNLKKYNLFSVSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVKSSAAYILFYTSLG

Molecular Formula

9101 (Gene_ID) P40818-1 (P734-G1110) (Accession)

Molecular Weight

Approximately 70.8 kDa

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rrp1 Rat siRNA Oligo Duplex (Locus ID 309674)
SR513490 1 Kit

Rrp1 Rat siRNA Oligo Duplex (Locus ID 309674)

Sign In for Pricing
View Details
Mouse IgG (Total) ELISA Kit
SEKM-0098-01 48 Tests

Mouse IgG (Total) ELISA Kit

Sign In for Pricing
View Details
Mouse IgG (Total) ELISA Kit
SEKM-0098-02 96 Tests

Mouse IgG (Total) ELISA Kit

Sign In for Pricing
View Details
Porcine T-Box Protein 3 ELISA Kit
MBS751541-01 48 Well

Porcine T-Box Protein 3 ELISA Kit

Sign In for Pricing
View Details
Porcine T-Box Protein 3 ELISA Kit
MBS751541-02 96 Well

Porcine T-Box Protein 3 ELISA Kit

Sign In for Pricing
View Details
Porcine T-Box Protein 3 ELISA Kit
MBS751541-03 5x 96 Well

Porcine T-Box Protein 3 ELISA Kit

Sign In for Pricing
View Details