Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant BK polyomavirus Large T antigen, partial

Product Specifications

Product Name Alternative

LT; LT-AG

Abbreviation

Recombinant BK polyomavirus Large T antigen protein, partial

UniProt

P03071

Expression Region

1-133aa

Organism

BK polyomavirus (BKPyV) (Human polyomavirus 1)

Target Sequence

MDKVLNREESMELMDLLGLERAAWGNLPLMRKAYLRKCKEFHPDKGGDEDKMKRMNTLYKKMEQDVKVAHQPDFGTWSSSEVPTYGTEEWESWWSSFNEKWDEDLFCHEDMFASDEEATADSQHSTPPKKKRK

Tag

N-terminal 6xHis-tagged and C-terminal Avi-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Isoform large T antigen is a key early protein essential for both driving viral replication and inducing cellular transformation. Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle and by autoregulating the synthesis of viral early mRNA. Displays highly oncogenic activities by corrupting the host cellular checkpoint mechanisms that guard cell division and the transcription, replication, and repair of DNA. Participates in the modulation of cellular gene expression preceeding viral DNA replication. This step involves binding to host key cell cycle regulators retinoblastoma protein RB1/pRb and TP53. Induces the disassembly of host E2F1 transcription factors from RB1, thus promoting transcriptional activation of E2F1-regulated S-phase genes. Inhibits host TP53 binding to DNA, abrogating the ability of TP53 to stimulate gene expression. Plays the role of a TFIID-associated factor (TAF) in transcription initiation for all three RNA polymerases, by stabilizing the TBP-TFIIA complex on promoters. Initiates viral DNA replication and unwinding via interactions with the viral origin of replication. Binds two adjacent sites in the SV40 origin. The replication fork movement is facilitated by Large T antigen helicase activity. Activates the transcription of viral late mRNA, through host TBP and TFIIA stabilization. Interferes with histone deacetylation mediated by HDAC1, leading to activation of transcription.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acetophenone-13C6
TRC-A164016-50MG 50 mg

Acetophenone-13C6

Sign In for Pricing
View Details
Genistein 7-Sulfate Sodium Salt
TRC-G350045-25MG 25 mg

Genistein 7-Sulfate Sodium Salt

Sign In for Pricing
View Details
Benzophenone-13C
TRC-B428003-50MG 50 mg

Benzophenone-13C

Sign In for Pricing
View Details
P40 (deltaNp63) (Squamous, Basal & Myoepithelial Cell Marker), CF647 conjugate, 0.1mg/mL
BNC472314-500 1x 500 µL

P40 (deltaNp63) (Squamous, Basal & Myoepithelial Cell Marker), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Steviolbioside
TRC-S686760-25MG 25 mg

Steviolbioside

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS706171 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details