Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Usherin (Ush2A), partial

Product Specifications

Product Name Alternative

(Usher syndrome type IIa protein homolog) (Usher syndrome type-2A protein homolog)

Abbreviation

Recombinant Mouse Ush2A protein, partial

Gene Name

Ush2A

UniProt

Q2QI47

Expression Region

265-517aa

Organism

Mus musculus (Mouse)

Target Sequence

GRMQDFRLYNVSLTNREILEVFSGDFPHLHIQPHCRCPGSHPRVHPSVQQYCIPNGAGDTPEHRMSRLNPEAHPLSFINDDDVATSWISHVFTNITQLYEGVAISIDLENGQYQVLKVITQFSSLQPVAIRIQRKKADSSPWEDWQYFARNCSVWGMKDNEDLENPNSVNCLQLPDFIPFSHGNVTFDLLTSGQKHRPGYNDFYNSSVLQEFMRATQIRLHFHGQYYPAGHTVDWRHQYYAVDEIIVSGRCQC

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Neuroscience

Relevance

Involved in hearing and vision as member of the USH2 complex. In the inner ear, required for the maintenance of hair bundle ankle formation, which connects growing stereocilia in developing cochlear hair cells. In retina photoreceptors, the USH2 complex is required for the maintenance of periciliary membrane complex that seems to play a role in regulating intracellular protein transport.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

30.7 kDa

References & Citations

"Deletion of PDZD7 disrupts the Usher syndrome type 2 protein complex in cochlear hair cells and causes hearing loss in mice." Zou J., Zheng T., Ren C., Askew C., Liu X.P., Pan B., Holt J.R., Wang Y., Yang J. Hum. Mol. Genet. 23:2374-2390 (2014)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine CD97 ELISA Kit
MBS747388-01 48 Well

Bovine CD97 ELISA Kit

Sign In for Pricing
View Details
Bovine CD97 ELISA Kit
MBS747388-02 96 Well

Bovine CD97 ELISA Kit

Sign In for Pricing
View Details
Bovine CD97 ELISA Kit
MBS747388-03 5x 96 Well

Bovine CD97 ELISA Kit

Sign In for Pricing
View Details
Bovine CD97 ELISA Kit
MBS747388-04 10x 96 Well

Bovine CD97 ELISA Kit

Sign In for Pricing
View Details
Recombinant Shigella flexneri serotype 5b Thymidylate synthase (thyA)
MBS1388322-01 0.02 mg (E-Coli)

Recombinant Shigella flexneri serotype 5b Thymidylate synthase (thyA)

Sign In for Pricing
View Details
Recombinant Shigella flexneri serotype 5b Thymidylate synthase (thyA)
MBS1388322-02 0.02 mg (Yeast)

Recombinant Shigella flexneri serotype 5b Thymidylate synthase (thyA)

Sign In for Pricing
View Details