Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Betacellulin, Human (HEK293)

Probetacellulin Protein, Human (HEK293) is a glycoprotein produced in HEK293 cells, improves glucose tolerance by promoting β-cell differentiation and regeneration from ductal and/or acinar cells.

Product Specifications

Product Name Alternative

Betacellulin Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/probetacellulin-protein-human-hek293.html

Purity

96.50

Smiles

DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY

Molecular Formula

685 (Gene_ID) P35070 (D32-Y111) (Accession)

Molecular Weight

15-18 kDa

References & Citations

[1]Yamamoto K, et al. Recombinant human betacellulin promotes the neogenesis of beta-cells and ameliorates glucose intolerance in mice with diabetes induced by selective alloxan perfusion. Diabetes. 2000 Dec;49 (12) :2021-7.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FARP1 Knockout jurkat Polyclonal Cells
ARG13151 1 Million

FARP1 Knockout jurkat Polyclonal Cells

Sign In for Pricing
View Details
PPM1B sgRNA CRISPR Lentivector set (Human)
K1700401 3x 1.0 µg

PPM1B sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
K2C80 rabbit pAb
MBS8599430-01 0.1 mL

K2C80 rabbit pAb

Sign In for Pricing
View Details
K2C80 rabbit pAb
MBS8599430-02 0.1 mL (AF405L)

K2C80 rabbit pAb

Sign In for Pricing
View Details
K2C80 rabbit pAb
MBS8599430-03 0.1 mL (AF405S)

K2C80 rabbit pAb

Sign In for Pricing
View Details
K2C80 rabbit pAb
MBS8599430-04 0.1 mL (AF610)

K2C80 rabbit pAb

Sign In for Pricing
View Details