Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Betacellulin, Human (HEK293)

Probetacellulin Protein, Human (HEK293) is a glycoprotein produced in HEK293 cells, improves glucose tolerance by promoting β-cell differentiation and regeneration from ductal and/or acinar cells.

Product Specifications

Product Name Alternative

Betacellulin Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/probetacellulin-protein-human-hek293.html

Purity

96.50

Smiles

DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY

Molecular Formula

685 (Gene_ID) P35070 (D32-Y111) (Accession)

Molecular Weight

15-18 kDa

References & Citations

[1]Yamamoto K, et al. Recombinant human betacellulin promotes the neogenesis of beta-cells and ameliorates glucose intolerance in mice with diabetes induced by selective alloxan perfusion. Diabetes. 2000 Dec;49 (12) :2021-7.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1198 ORF Vector (Rat) (pORF)
ORF071841 1.0 µg DNA

Olr1198 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Mouse Monoclonal C15orf40 Antibody (OTI2B7) [CoraFluor 1]
NBP2-72375CL1 0.1 mL

Mouse Monoclonal C15orf40 Antibody (OTI2B7) [CoraFluor 1]

Sign In for Pricing
View Details
TMEM151A Protein Vector (Mouse) (pPB-C-His)
PV239150 500 ng

TMEM151A Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
CD36 (CD36 Antigen, Fatty Acid Translocase, FAT, Glycoprotein IIIb, gpIIIb, gp3b, gpIV, gp4, Leukocyte Differentiation Antigen CD36, PAS-4 Protein, PAS-IV, PASIV, Platelet Collagen Receptor, Platelet Glycoprotein 4, Platelet Glycoprotein IV, Scarb3, Thrombospondin Receptor) (MaxLight 650)
C2388-01R1-ML650 100 µL

CD36 (CD36 Antigen, Fatty Acid Translocase, FAT, Glycoprotein IIIb, gpIIIb, gp3b, gpIV, gp4, Leukocyte Differentiation Antigen CD36, PAS-4 Protein, PAS-IV, PASIV, Platelet Collagen Receptor, Platelet Glycoprotein 4, Platelet Glycoprotein IV, Scarb3, Thrombospondin Receptor) (MaxLight 650)

Sign In for Pricing
View Details
TEP1 3'UTR GFP Stable Cell Line
TU075407 1.0 mL

TEP1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Mouse OTU domain-containing protein 7A, Otud7a ELISA KIT
ELI-45190m 96 Tests

Mouse OTU domain-containing protein 7A, Otud7a ELISA KIT

Sign In for Pricing
View Details