Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Betacellulin, Human (HEK293)

Probetacellulin Protein, Human (HEK293) is a glycoprotein produced in HEK293 cells, improves glucose tolerance by promoting β-cell differentiation and regeneration from ductal and/or acinar cells.

Product Specifications

Product Name Alternative

Betacellulin Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/probetacellulin-protein-human-hek293.html

Purity

96.50

Smiles

DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY

Molecular Formula

685 (Gene_ID) P35070 (D32-Y111) (Accession)

Molecular Weight

15-18 kDa

References & Citations

[1]Yamamoto K, et al. Recombinant human betacellulin promotes the neogenesis of beta-cells and ameliorates glucose intolerance in mice with diabetes induced by selective alloxan perfusion. Diabetes. 2000 Dec;49 (12) :2021-7.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal ASF1b Antibody (002) [FITC]
NBP2-90278F 0.1 mL

Rabbit Monoclonal ASF1b Antibody (002) [FITC]

Sign In for Pricing
View Details
Mouse Monoclonal FATP4/SLC27A4 Antibody (342142) [Janelia Fluor 525]
FAB3650JF525 0.1 mL

Mouse Monoclonal FATP4/SLC27A4 Antibody (342142) [Janelia Fluor 525]

Sign In for Pricing
View Details
Mouse Monoclonal TRAF-1 Antibody (TRAF1/3299) [mFluor Violet 450 SE]
NBP3-27023MFV450 0.1 mL

Mouse Monoclonal TRAF-1 Antibody (TRAF1/3299) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Chicken Dihydropyrimidinase Like Protein 3 ELISA Kit
MBS735216-01 48 Well

Chicken Dihydropyrimidinase Like Protein 3 ELISA Kit

Sign In for Pricing
View Details
Chicken Dihydropyrimidinase Like Protein 3 ELISA Kit
MBS735216-02 96 Well

Chicken Dihydropyrimidinase Like Protein 3 ELISA Kit

Sign In for Pricing
View Details
Chicken Dihydropyrimidinase Like Protein 3 ELISA Kit
MBS735216-03 5x 96 Well

Chicken Dihydropyrimidinase Like Protein 3 ELISA Kit

Sign In for Pricing
View Details