Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Betacellulin, Human (HEK293)

Probetacellulin Protein, Human (HEK293) is a glycoprotein produced in HEK293 cells, improves glucose tolerance by promoting β-cell differentiation and regeneration from ductal and/or acinar cells.

Product Specifications

Product Name Alternative

Betacellulin Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/probetacellulin-protein-human-hek293.html

Purity

96.50

Smiles

DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY

Molecular Formula

685 (Gene_ID) P35070 (D32-Y111) (Accession)

Molecular Weight

15-18 kDa

References & Citations

[1]Yamamoto K, et al. Recombinant human betacellulin promotes the neogenesis of beta-cells and ameliorates glucose intolerance in mice with diabetes induced by selective alloxan perfusion. Diabetes. 2000 Dec;49 (12) :2021-7.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal HDGFRP3 Antibody (2G12)
H00050810-M01 0.1 mg

Mouse Monoclonal HDGFRP3 Antibody (2G12)

Sign In for Pricing
View Details
Mouse Anti-Human CD5 Monoclonal Antibody, FITC Conjugated Clone B-B8
MBS335389-01 100 Tests

Mouse Anti-Human CD5 Monoclonal Antibody, FITC Conjugated Clone B-B8

Sign In for Pricing
View Details
Mouse Anti-Human CD5 Monoclonal Antibody, FITC Conjugated Clone B-B8
MBS335389-02 5x 100 Tests

Mouse Anti-Human CD5 Monoclonal Antibody, FITC Conjugated Clone B-B8

Sign In for Pricing
View Details
Peretinoin
C04173 5 mg

Peretinoin

Sign In for Pricing
View Details
CMG1 (IFT74) (NM_001099222) Human Over-expression Lysate
LC420372 20 µg

CMG1 (IFT74) (NM_001099222) Human Over-expression Lysate

Sign In for Pricing
View Details
ATP synthase subunit beta, mitochondrial-like Mouse mAb for Plutella xylostella
MBS435439-01 0.05 mL

ATP synthase subunit beta, mitochondrial-like Mouse mAb for Plutella xylostella

Sign In for Pricing
View Details