Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Betacellulin, Human (HEK293)

Probetacellulin Protein, Human (HEK293) is a glycoprotein produced in HEK293 cells, improves glucose tolerance by promoting β-cell differentiation and regeneration from ductal and/or acinar cells.

Product Specifications

Product Name Alternative

Betacellulin Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/probetacellulin-protein-human-hek293.html

Purity

96.50

Smiles

DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY

Molecular Formula

685 (Gene_ID) P35070 (D32-Y111) (Accession)

Molecular Weight

15-18 kDa

References & Citations

[1]Yamamoto K, et al. Recombinant human betacellulin promotes the neogenesis of beta-cells and ameliorates glucose intolerance in mice with diabetes induced by selective alloxan perfusion. Diabetes. 2000 Dec;49 (12) :2021-7.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Asic2 Rat shRNA Plasmid (Locus ID 25364)
TR709506 1 Kit

Asic2 Rat shRNA Plasmid (Locus ID 25364)

Sign In for Pricing
View Details
Lentiviral human FIGLA shRNA (UAS) - Lentiviral human FIGLA shRNA (UAS, GFP) (25)
GTR15323363 1 Vial

Lentiviral human FIGLA shRNA (UAS) - Lentiviral human FIGLA shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
RV gE1 Mosaic (residues 157-176/374-390/213-239)
JBS-PR-1228 100 µg

RV gE1 Mosaic (residues 157-176/374-390/213-239)

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS529140 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
GTPBP4 (GTP Binding Protein 4, NGB, CRFG, NOG1) (MaxLight 405)
MBS6419714-01 0.1 mL

GTPBP4 (GTP Binding Protein 4, NGB, CRFG, NOG1) (MaxLight 405)

Sign In for Pricing
View Details
GTPBP4 (GTP Binding Protein 4, NGB, CRFG, NOG1) (MaxLight 405)
MBS6419714-02 5x 0.1 mL

GTPBP4 (GTP Binding Protein 4, NGB, CRFG, NOG1) (MaxLight 405)

Sign In for Pricing
View Details