Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Betacellulin, Human (HEK293)

Probetacellulin Protein, Human (HEK293) is a glycoprotein produced in HEK293 cells, improves glucose tolerance by promoting β-cell differentiation and regeneration from ductal and/or acinar cells.

Product Specifications

Product Name Alternative

Betacellulin Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/probetacellulin-protein-human-hek293.html

Purity

96.50

Smiles

DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY

Molecular Formula

685 (Gene_ID) P35070 (D32-Y111) (Accession)

Molecular Weight

15-18 kDa

References & Citations

[1]Yamamoto K, et al. Recombinant human betacellulin promotes the neogenesis of beta-cells and ameliorates glucose intolerance in mice with diabetes induced by selective alloxan perfusion. Diabetes. 2000 Dec;49 (12) :2021-7.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Xpress™ Human SLC30A3 Over-expressing Stable Cell Line
ABC-X2859 1 Vial

Xpress™ Human SLC30A3 Over-expressing Stable Cell Line

Sign In for Pricing
View Details
DNASE1L1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV709425 1.0 µg DNA

DNASE1L1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
RN5S169 Protein Vector (Human) (pPB-N-His)
PV116219 500 ng

RN5S169 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
HIV-2 gp36 (Human Immunodeficiency Virus-2) (MaxLight 650)
H6009-ML650 100 µL

HIV-2 gp36 (Human Immunodeficiency Virus-2) (MaxLight 650)

Sign In for Pricing
View Details
1,4-Dibromobutane
TRC-D425130-500G 500 g

1,4-Dibromobutane

Sign In for Pricing
View Details
Riok1 Mouse shRNA Plasmid (Locus ID 71340)
TR504537 1 Kit

Riok1 Mouse shRNA Plasmid (Locus ID 71340)

Sign In for Pricing
View Details