Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Betacellulin, Human (HEK293)

Probetacellulin Protein, Human (HEK293) is a glycoprotein produced in HEK293 cells, improves glucose tolerance by promoting β-cell differentiation and regeneration from ductal and/or acinar cells.

Product Specifications

Product Name Alternative

Betacellulin Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/probetacellulin-protein-human-hek293.html

Purity

96.50

Smiles

DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY

Molecular Formula

685 (Gene_ID) P35070 (D32-Y111) (Accession)

Molecular Weight

15-18 kDa

References & Citations

[1]Yamamoto K, et al. Recombinant human betacellulin promotes the neogenesis of beta-cells and ameliorates glucose intolerance in mice with diabetes induced by selective alloxan perfusion. Diabetes. 2000 Dec;49 (12) :2021-7.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR2T1 Rabbit Polyclonal Antibody
TA342719 100 µL

OR2T1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ARHGAP24 Protein Vector (Mouse) (pPM-C-His)
PV155757 500 ng

ARHGAP24 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
L-Phenylalanine benzyl ester hydrochloride 100g
A23561-100000 100000 mg

L-Phenylalanine benzyl ester hydrochloride 100g

Sign In for Pricing
View Details
CD72 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0403707 1.0 µg DNA

CD72 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Tectb sgRNA CRISPR Lentivector (Rat) (Target 3)
K6461504 1.0 µg DNA

Tectb sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Recombinant Xenopus laevis Forkhead box protein D5-A (foxd5-a)
MBS1426319-01 0.02 mg (E-Coli)

Recombinant Xenopus laevis Forkhead box protein D5-A (foxd5-a)

Sign In for Pricing
View Details