Betacellulin, Human (HEK293)
Probetacellulin Protein, Human (HEK293) is a glycoprotein produced in HEK293 cells, improves glucose tolerance by promoting β-cell differentiation and regeneration from ductal and/or acinar cells.
Product Specifications
Product Name Alternative
Betacellulin Protein, Human (HEK293), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Applications
Neuroscience-Neuromodulation
Assay Protocol
https://www.medchemexpress.com/cytokines/probetacellulin-protein-human-hek293.html
Purity
96.50
Smiles
DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY
Molecular Formula
685 (Gene_ID) P35070 (D32-Y111) (Accession)
Molecular Weight
15-18 kDa
References & Citations
[1]Yamamoto K, et al. Recombinant human betacellulin promotes the neogenesis of beta-cells and ameliorates glucose intolerance in mice with diabetes induced by selective alloxan perfusion. Diabetes. 2000 Dec;49 (12) :2021-7.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
K4164608 1.0 µg DNA
Olfr1513 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
Sign In for Pricing
View Details MBS1408158-01 0.02 mg (E-Coli)
Recombinant Vibrio fischeri Exodeoxyribonuclease 7 large subunit (xseA)
Sign In for Pricing
View Details 
MBS1408158-02 0.02 mg (Yeast)
Recombinant Vibrio fischeri Exodeoxyribonuclease 7 large subunit (xseA)
Sign In for Pricing
View Details MBS1408158-03 0.1 mg (E-Coli)
Recombinant Vibrio fischeri Exodeoxyribonuclease 7 large subunit (xseA)
Sign In for Pricing
View Details MBS1408158-04 0.1 mg (Yeast)
Recombinant Vibrio fischeri Exodeoxyribonuclease 7 large subunit (xseA)
Sign In for Pricing
View Details MBS1408158-05 0.02 mg (Baculovirus)
Recombinant Vibrio fischeri Exodeoxyribonuclease 7 large subunit (xseA)
Sign In for Pricing
View Details