Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Betacellulin, Human (HEK293)

Probetacellulin Protein, Human (HEK293) is a glycoprotein produced in HEK293 cells, improves glucose tolerance by promoting β-cell differentiation and regeneration from ductal and/or acinar cells.

Product Specifications

Product Name Alternative

Betacellulin Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/probetacellulin-protein-human-hek293.html

Purity

96.50

Smiles

DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY

Molecular Formula

685 (Gene_ID) P35070 (D32-Y111) (Accession)

Molecular Weight

15-18 kDa

References & Citations

[1]Yamamoto K, et al. Recombinant human betacellulin promotes the neogenesis of beta-cells and ameliorates glucose intolerance in mice with diabetes induced by selective alloxan perfusion. Diabetes. 2000 Dec;49 (12) :2021-7.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HNF1 beta Antibody
ASA-B0881 1 Each

HNF1 beta Antibody

Sign In for Pricing
View Details
Lentiviral mouse Tmem68 shRNA (UAS) - Lentiviral mouse Tmem68 shRNA (UAS) (100)
GTR15204570 1 Vial

Lentiviral mouse Tmem68 shRNA (UAS) - Lentiviral mouse Tmem68 shRNA (UAS) (100)

Sign In for Pricing
View Details
Rabbit Polyclonal ARFGEF1 Antibody [DyLight 755]
NB100-55257IR 0.1 mL

Rabbit Polyclonal ARFGEF1 Antibody [DyLight 755]

Sign In for Pricing
View Details
TNFAIP8L3 Antibody
ASA-B1892 1 Each

TNFAIP8L3 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Reg4 Antibody [DyLight 755]
NBP2-99734IR 0.1 mL

Rabbit Polyclonal Reg4 Antibody [DyLight 755]

Sign In for Pricing
View Details
SET Protein Vector (Human) (pPB-N-His)
PV037634 500 ng

SET Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details