Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Betacellulin, Human (HEK293)

Probetacellulin Protein, Human (HEK293) is a glycoprotein produced in HEK293 cells, improves glucose tolerance by promoting β-cell differentiation and regeneration from ductal and/or acinar cells.

Product Specifications

Product Name Alternative

Betacellulin Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/probetacellulin-protein-human-hek293.html

Purity

96.50

Smiles

DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY

Molecular Formula

685 (Gene_ID) P35070 (D32-Y111) (Accession)

Molecular Weight

15-18 kDa

References & Citations

[1]Yamamoto K, et al. Recombinant human betacellulin promotes the neogenesis of beta-cells and ameliorates glucose intolerance in mice with diabetes induced by selective alloxan perfusion. Diabetes. 2000 Dec;49 (12) :2021-7.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pseudomonas syringae pv. syringae UPF0060 membrane protein Psyr_3752 (Psyr_3752)
MBS7039400-01 0.02 mg

Recombinant Pseudomonas syringae pv. syringae UPF0060 membrane protein Psyr_3752 (Psyr_3752)

Sign In for Pricing
View Details
Recombinant Pseudomonas syringae pv. syringae UPF0060 membrane protein Psyr_3752 (Psyr_3752)
MBS7039400-02 0.1 mg

Recombinant Pseudomonas syringae pv. syringae UPF0060 membrane protein Psyr_3752 (Psyr_3752)

Sign In for Pricing
View Details
Recombinant Pseudomonas syringae pv. syringae UPF0060 membrane protein Psyr_3752 (Psyr_3752)
MBS7039400-03 5x 0.1 mg

Recombinant Pseudomonas syringae pv. syringae UPF0060 membrane protein Psyr_3752 (Psyr_3752)

Sign In for Pricing
View Details
Olr93 (NM_001000141) Rat Tagged ORF Clone Lentiviral Particle
RR209175L4V 200 µL

Olr93 (NM_001000141) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Integrin Alpha-6 (ITGA6) Protein
abx658233-01 10 µg

Mouse Integrin Alpha-6 (ITGA6) Protein

Sign In for Pricing
View Details
Mouse Integrin Alpha-6 (ITGA6) Protein
abx658233-02 50 µg

Mouse Integrin Alpha-6 (ITGA6) Protein

Sign In for Pricing
View Details