Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Betacellulin, Human (HEK293)

Probetacellulin Protein, Human (HEK293) is a glycoprotein produced in HEK293 cells, improves glucose tolerance by promoting β-cell differentiation and regeneration from ductal and/or acinar cells.

Product Specifications

Product Name Alternative

Betacellulin Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/probetacellulin-protein-human-hek293.html

Purity

96.50

Smiles

DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY

Molecular Formula

685 (Gene_ID) P35070 (D32-Y111) (Accession)

Molecular Weight

15-18 kDa

References & Citations

[1]Yamamoto K, et al. Recombinant human betacellulin promotes the neogenesis of beta-cells and ameliorates glucose intolerance in mice with diabetes induced by selective alloxan perfusion. Diabetes. 2000 Dec;49 (12) :2021-7.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1423 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4213708 1.0 µg DNA

Olfr1423 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
DBI, Mouse (His-Myc)
HY-P72167-01 20 µg

DBI, Mouse (His-Myc)

Sign In for Pricing
View Details
DBI, Mouse (His-Myc)
HY-P72167-02 50 µg

DBI, Mouse (His-Myc)

Sign In for Pricing
View Details
MN-2633 N- (1a,5a,6a) -3-Azabicyclo[3.1.0]hex-6-yl-carbamic acid 1,1-dimethylethyl ester
JH123263 1 Each

MN-2633 N- (1a,5a,6a) -3-Azabicyclo[3.1.0]hex-6-yl-carbamic acid 1,1-dimethylethyl ester

Sign In for Pricing
View Details
Mouse Galectin 9C (GAL9C) ELISA Kit
MBS9303349-01 48 Well

Mouse Galectin 9C (GAL9C) ELISA Kit

Sign In for Pricing
View Details
Mouse Galectin 9C (GAL9C) ELISA Kit
MBS9303349-02 96 Well

Mouse Galectin 9C (GAL9C) ELISA Kit

Sign In for Pricing
View Details