Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Betacellulin, Human (HEK293)

Probetacellulin Protein, Human (HEK293) is a glycoprotein produced in HEK293 cells, improves glucose tolerance by promoting β-cell differentiation and regeneration from ductal and/or acinar cells.

Product Specifications

Product Name Alternative

Betacellulin Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/probetacellulin-protein-human-hek293.html

Purity

96.50

Smiles

DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY

Molecular Formula

685 (Gene_ID) P35070 (D32-Y111) (Accession)

Molecular Weight

15-18 kDa

References & Citations

[1]Yamamoto K, et al. Recombinant human betacellulin promotes the neogenesis of beta-cells and ameliorates glucose intolerance in mice with diabetes induced by selective alloxan perfusion. Diabetes. 2000 Dec;49 (12) :2021-7.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFB3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1410607 1.0 µg DNA

NDUFB3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Recombinant Mouse Tnfrsf14 Protein, His-Fc-tagged, Alexa Fluor 488 conjugated
Tnfrsf14-428MAF488 20 μg- 50 μg- 100 μg

Recombinant Mouse Tnfrsf14 Protein, His-Fc-tagged, Alexa Fluor 488 conjugated

Sign In for Pricing
View Details
PDE4A, NT (PDE4A, DPDE2, cAMP-specific 3',5'-cyclic phosphodiesterase 4A, PDE46) (AP)
MBS6332122-01 0.2 mL

PDE4A, NT (PDE4A, DPDE2, cAMP-specific 3',5'-cyclic phosphodiesterase 4A, PDE46) (AP)

Sign In for Pricing
View Details
PDE4A, NT (PDE4A, DPDE2, cAMP-specific 3',5'-cyclic phosphodiesterase 4A, PDE46) (AP)
MBS6332122-02 5x 0.2 mL

PDE4A, NT (PDE4A, DPDE2, cAMP-specific 3',5'-cyclic phosphodiesterase 4A, PDE46) (AP)

Sign In for Pricing
View Details
Betacellulin, NT (BTC, Probetacellulin) (APC)
MBS6279155-01 0.2 mL

Betacellulin, NT (BTC, Probetacellulin) (APC)

Sign In for Pricing
View Details
Betacellulin, NT (BTC, Probetacellulin) (APC)
MBS6279155-02 5x 0.2 mL

Betacellulin, NT (BTC, Probetacellulin) (APC)

Sign In for Pricing
View Details