Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Betacellulin, Human (HEK293)

Probetacellulin Protein, Human (HEK293) is a glycoprotein produced in HEK293 cells, improves glucose tolerance by promoting β-cell differentiation and regeneration from ductal and/or acinar cells.

Product Specifications

Product Name Alternative

Betacellulin Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/probetacellulin-protein-human-hek293.html

Purity

96.50

Smiles

DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY

Molecular Formula

685 (Gene_ID) P35070 (D32-Y111) (Accession)

Molecular Weight

15-18 kDa

References & Citations

[1]Yamamoto K, et al. Recombinant human betacellulin promotes the neogenesis of beta-cells and ameliorates glucose intolerance in mice with diabetes induced by selective alloxan perfusion. Diabetes. 2000 Dec;49 (12) :2021-7.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Tryptophan (TRP) ELISA Kit
abx055417 96 Well

Human Tryptophan (TRP) ELISA Kit

Sign In for Pricing
View Details
Glutarylcarnitine lithium
MBS5815830 Inquire

Glutarylcarnitine lithium

Sign In for Pricing
View Details
Human glucose oxidase,GOD ELISA Kit
CN-04496H1 96T

Human glucose oxidase,GOD ELISA Kit

Sign In for Pricing
View Details
GENLISA™ Human Galanin-Like Peptide (GALP) ELISA
KBH4655 1x 96 Well

GENLISA™ Human Galanin-Like Peptide (GALP) ELISA

Sign In for Pricing
View Details
FGF19 (Fibroblast Growth Factor 19, FGF-19, UNQ334/PRO533)
406458-01 50 µL

FGF19 (Fibroblast Growth Factor 19, FGF-19, UNQ334/PRO533)

Sign In for Pricing
View Details
FGF19 (Fibroblast Growth Factor 19, FGF-19, UNQ334/PRO533)
406458-02 100 µL

FGF19 (Fibroblast Growth Factor 19, FGF-19, UNQ334/PRO533)

Sign In for Pricing
View Details