Betacellulin, Human (HEK293)
Probetacellulin Protein, Human (HEK293) is a glycoprotein produced in HEK293 cells, improves glucose tolerance by promoting β-cell differentiation and regeneration from ductal and/or acinar cells.
Product Specifications
Product Name Alternative
Betacellulin Protein, Human (HEK293), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Applications
Neuroscience-Neuromodulation
Assay Protocol
https://www.medchemexpress.com/cytokines/probetacellulin-protein-human-hek293.html
Purity
96.50
Smiles
DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY
Molecular Formula
685 (Gene_ID) P35070 (D32-Y111) (Accession)
Molecular Weight
15-18 kDa
References & Citations
[1]Yamamoto K, et al. Recombinant human betacellulin promotes the neogenesis of beta-cells and ameliorates glucose intolerance in mice with diabetes induced by selective alloxan perfusion. Diabetes. 2000 Dec;49 (12) :2021-7.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
P9109-45Y-AP 200 µL
PRL1 (Protein Tyrosine Phosphatase Type IVA 1, Protein-tyrosine Phosphatase 4a1, Protein-tyrosine Phosphatase Of Regenerating Liver 1, PRL-1, PTP (CAAXI), PTP4A1, PTPCAAX1) (AP) discontinued
Sign In for Pricing
View Details 
![Mouse Monoclonal Cyclin B1 Antibody (V92.1) [DyLight 405]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
NB100-2648V 0.1 mL
Mouse Monoclonal Cyclin B1 Antibody (V92.1) [DyLight 405]
Sign In for Pricing
View Details MBS2068275-01 0.1 mL
FITC-Linked Polyclonal Antibody to Tumor Necrosis Factor Alpha Induced Protein 3 (TNFaIP3)
Sign In for Pricing
View Details MBS2068275-02 0.2 mL
FITC-Linked Polyclonal Antibody to Tumor Necrosis Factor Alpha Induced Protein 3 (TNFaIP3)
Sign In for Pricing
View Details