Betacellulin, Human (HEK293)
Probetacellulin Protein, Human (HEK293) is a glycoprotein produced in HEK293 cells, improves glucose tolerance by promoting β-cell differentiation and regeneration from ductal and/or acinar cells.
Product Specifications
Product Name Alternative
Betacellulin Protein, Human (HEK293), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Applications
Neuroscience-Neuromodulation
Assay Protocol
https://www.medchemexpress.com/cytokines/probetacellulin-protein-human-hek293.html
Purity
96.50
Smiles
DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY
Molecular Formula
685 (Gene_ID) P35070 (D32-Y111) (Accession)
Molecular Weight
15-18 kDa
References & Citations
[1]Yamamoto K, et al. Recombinant human betacellulin promotes the neogenesis of beta-cells and ameliorates glucose intolerance in mice with diabetes induced by selective alloxan perfusion. Diabetes. 2000 Dec;49 (12) :2021-7.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15117949 1 Vial
Lentiviral human TOX2 shRNA (UAS) - Lentiviral human TOX2 shRNA (UAS, RFP) plasmid
Sign In for Pricing
View Details MBS6004472-01 0.2 mL
CLEC10A, NT (CLEC10A, CLECSF13, CLECSF14, HML, C-type lectin domain family 10 member A, C-type lectin superfamily member 14, Macrophage lectin 2, CD301)
Sign In for Pricing
View Details 
MBS6004472-02 5x 0.2 mL
CLEC10A, NT (CLEC10A, CLECSF13, CLECSF14, HML, C-type lectin domain family 10 member A, C-type lectin superfamily member 14, Macrophage lectin 2, CD301)
Sign In for Pricing
View Details 