Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXO48, Human (His, Myc)

The FBXO48 Protein is part of the SCF ubiquitin ligase complex and participates in the catabolism of SCF-dependent proteasome ubiquitin-dependent proteins. The FBXO48 Protein undergoes polyubiquitination and proteasome degradation by targeting activity-phosphorylated Ampk (PAMPK-) . FBXO48 Protein, Human (His) is the recombinant human-derived FBXO48 protein, expressed by E. coli , with N-His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

FBXO48 Protein, Human (His, Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fbxo48-protein-human-his.html

Purity

97.00

Smiles

MHKNSKRNNNLRVSHTEANSVDAEKEKNESQNNFFELLPAEITFKIFSQLDIRSLCRASLTCRSWNDTIRNSDSLWKPHCMTVRAVCRREIDDDLESGYSWRVILLRNYQKSKVKHEWLSGRYSNICSPISLPEKIMYPMDADTWGEILEAELER

Molecular Formula

554251 (Gene_ID) Q5FWF7 (M1-R155) (Accession)

Molecular Weight

Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRP-Linked Polyclonal Antibody to Lipocalin 9 (LCN9)
MBS2074033-01 0.1 mL

HRP-Linked Polyclonal Antibody to Lipocalin 9 (LCN9)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Lipocalin 9 (LCN9)
MBS2074033-02 0.2 mL

HRP-Linked Polyclonal Antibody to Lipocalin 9 (LCN9)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Lipocalin 9 (LCN9)
MBS2074033-03 0.5 mL

HRP-Linked Polyclonal Antibody to Lipocalin 9 (LCN9)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Lipocalin 9 (LCN9)
MBS2074033-04 1 mL

HRP-Linked Polyclonal Antibody to Lipocalin 9 (LCN9)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Lipocalin 9 (LCN9)
MBS2074033-05 5 mL

HRP-Linked Polyclonal Antibody to Lipocalin 9 (LCN9)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Lipocalin 9 (LCN9)
MBS2074033-06 5x 5 mL

HRP-Linked Polyclonal Antibody to Lipocalin 9 (LCN9)

Sign In for Pricing
View Details