Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia akari Ribonuclease P protein component (rnpA)

Product Specifications

CAS Number

9000-83-3

Gene Name

[rnpA]

Storage Conditions

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Other Gene Names

[rnpA; RNase P protein; RNaseP protein]

Short Name

[Ribonuclease P protein component (rnpA)]

Other Product Names

[ribonuclease P protein component; Ribonuclease P protein component; Protein C5]

NCBI GI Number

501099976

NCBI Accession Number

WP_012149846.1

NCBI GB Accession Number

WP_012149846.1

Uniprot Accession Number

A8GP91

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Feline Immunoglobulin G (IgG) ELISA Kit-Sandwich
EK8F240-01 48 Test

Feline Immunoglobulin G (IgG) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Feline Immunoglobulin G (IgG) ELISA Kit-Sandwich
EK8F240-02 96 Tests

Feline Immunoglobulin G (IgG) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Plekha8 3'UTR Luciferase Stable Cell Line
TU216391 1.0 mL

Plekha8 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
MF-0155578-01 5 mg

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Sign In for Pricing
View Details
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
MF-0155578-02 50 mg

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Sign In for Pricing
View Details
PTCHD1 (NM_173495) Human Tagged Lenti ORF Clone
RC212638L4 10 µg

PTCHD1 (NM_173495) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details