Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NHP2L1, Human (His)

NHP2L1 is integral to ribosome biogenesis and is a key member of the small subunit (SSU) processing group, the precursor of the eukaryotic ribosomal small subunit. The SSU processing group assembles in the nucleolus and cooperates with the folding, modification, rearrangement, cleavage and targeted degradation of nascent pre-rRNA promoted by RNA exosomes. NHP2L1 Protein, Human (His) is the recombinant human-derived NHP2L1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

NHP2L1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nhp2l1-protein-human-his.html

Smiles

MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV

Molecular Formula

4809 (Gene_ID) P55769 (M1-V128) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Hornerin ELISA Kit
MBS760501-01 48 Well

Human Hornerin ELISA Kit

Ask
View Details
Human Hornerin ELISA Kit
MBS760501-02 96 Well

Human Hornerin ELISA Kit

Ask
View Details
Human Hornerin ELISA Kit
MBS760501-03 5x 96 Well

Human Hornerin ELISA Kit

Ask
View Details
Human Hornerin ELISA Kit
MBS760501-04 10x 96 Well

Human Hornerin ELISA Kit

Ask
View Details
Nmrk1 Rat Pre-designed siRNA Set A
HY-RS29194 1 Set

Nmrk1 Rat Pre-designed siRNA Set A

Ask
View Details
Tspyl1 (NM_001013033) Rat Tagged ORF Clone Lentiviral Particle
RR214045L3V 200 µL

Tspyl1 (NM_001013033) Rat Tagged ORF Clone Lentiviral Particle

Ask
View Details