NHP2L1, Human (His)
NHP2L1 is integral to ribosome biogenesis and is a key member of the small subunit (SSU) processing group, the precursor of the eukaryotic ribosomal small subunit. The SSU processing group assembles in the nucleolus and cooperates with the folding, modification, rearrangement, cleavage and targeted degradation of nascent pre-rRNA promoted by RNA exosomes. NHP2L1 Protein, Human (His) is the recombinant human-derived NHP2L1 protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
NHP2L1 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/nhp2l1-protein-human-his.html
Smiles
MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
Molecular Formula
4809 (Gene_ID) P55769 (M1-V128) (Accession)
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items