Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NHP2L1, Human (His)

NHP2L1 is integral to ribosome biogenesis and is a key member of the small subunit (SSU) processing group, the precursor of the eukaryotic ribosomal small subunit. The SSU processing group assembles in the nucleolus and cooperates with the folding, modification, rearrangement, cleavage and targeted degradation of nascent pre-rRNA promoted by RNA exosomes. NHP2L1 Protein, Human (His) is the recombinant human-derived NHP2L1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

NHP2L1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nhp2l1-protein-human-his.html

Smiles

MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV

Molecular Formula

4809 (Gene_ID) P55769 (M1-V128) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Ginsenoside Rh1 discontinued
371499 5 mg

Ginsenoside Rh1 discontinued

Ask
View Details
Rabbit Monoclonal Cytokeratin, pan Antibody (Cocktail PCK/4933R) [CoraFluor 1]
NBP3-14098CL1 0.1 mL

Rabbit Monoclonal Cytokeratin, pan Antibody (Cocktail PCK/4933R) [CoraFluor 1]

Ask
View Details
ZMYND19 (Zinc Finger MYND Domain-Containing Protein 19, Zinc Finger, MYND-Type Containing 19)
496138 100 µL

ZMYND19 (Zinc Finger MYND Domain-Containing Protein 19, Zinc Finger, MYND-Type Containing 19)

Ask
View Details
Tryptone, Casein Digest Peptone, Tryptic digest of Casein
T2007-050 500 g

Tryptone, Casein Digest Peptone, Tryptic digest of Casein

Ask
View Details