Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Poly [ADP-ribose] polymerase 14 (PARP14), partial

Product Specifications

Product Name Alternative

ADP-ribosyltransferase diphtheria toxin-like 8 B aggressive lymphoma protein 2 Poly [ADP-ribose] polymerase 14

Abbreviation

Recombinant Human PARP14 protein, partial

Gene Name

PARP14

UniProt

Q460N5

Expression Region

1605-1801aa

Organism

Homo sapiens (Human)

Target Sequence

IPAHWSDMKQQNFCVVELLPSDPEYNTVASKFNQTCSHFRIEKIERIQNPDLWNSYQAKKKTMDAKNGQTMNEKQLFHGTDAGSVPHVNRNGFNRSYAGKNAVAYGKGTYFAVNANYSANDTYSRPDANGRKHVYYVRVLTGIYTHGNHSLIVPPSKNPQNPTDLYDTVTDNVHHPSLFVAFYDYQAYPEYLITFRK

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Epigenetics and Nuclear Signaling

Relevance

ADP-ribosyltransferase that mediates mono-ADP-ribosylation of glutamate residues on target proteins (PubMed:16061477, PubMed:27796300, PubMed:18851833, PubMed:25043379) . In contrast to PARP1 and PARP2, it is not able to mediate poly-ADP-ribosylation (PubMed:25043379) . Has been shown to catalyze the mono-ADP-ribosylation of STAT1 at 'Glu-657' and 'Glu-705', thus decreasing STAT1 phosphorylation which negatively regulates pro-inflammatory cytokine production in macrophages in response to IFNG stimulation (PubMed:27796300) . However, the role of ADP-ribosylation in the prevention of STAT1 phosphorylation has been called into question and it has been suggested that the inhibition of phosphorylation may be the result of sumoylation of STAT1 'Lys-703' (PubMed:29858569) . Mono-ADP-ribosylates STAT6; enhancing STAT6-dependent transcription (PubMed:27796300) . In macrophages, positively regulates MRC1 expression in response to IL4 stimulation by promoting STAT6 phosphorylation (PubMed:27796300) . Mono-ADP-ribosylates PARP9 (PubMed:27796300) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

26.5 kDa

References & Citations

"Poly (ADP-ribose) polymerase family member 14 (PARP14) is a novel effector of the JNK2-dependent pro-survival signal in multiple myeloma." Barbarulo A., Iansante V., Chaidos A., Naresh K., Rahemtulla A., Franzoso G., Karadimitris A., Haskard D.O., Papa S., Bubici C. Oncogene 32:4231-4242 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12929788/

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit anti-Escherichia coli O7:K1 (strain IAI39/ExPEC) HCAB Polyclonal Antibody
MBS7178168 Inquire

Rabbit anti-Escherichia coli O7:K1 (strain IAI39/ExPEC) HCAB Polyclonal Antibody

Ask
View Details
3-(3'-Fluorobenzyloxy)phenylboronic acid
sc-298764 250 mg

3-(3'-Fluorobenzyloxy)phenylboronic acid

Ask
View Details
C21ORF18 Antibody - C-terminal region: Biotin (ARP34564_P050-Biotin)
ARP34564_P050-Biotin 100 µL

C21ORF18 Antibody - C-terminal region: Biotin (ARP34564_P050-Biotin)

Ask
View Details
ARHGEF40 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
12342124 3 x 1.0μg DNA

ARHGEF40 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Ask
View Details