Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIV-1/SLC39A6, Cynomolgus (sf9, His)

LIV-1/SLC39A6 is a zinc influx transporter that regulates zinc homeostasis and induces epithelial-mesenchymal transition (EMT) . Used in conjunction with SLC39A10, it can promote cellular zinc absorption and trigger EMT. LIV-1/SLC39A6 Protein, Cynomolgus (sf9, His) is the recombinant cynomolgus-derived LIV-1/SLC39A6 protein, expressed by sf9 insect cells , with C-His labeled tag.

Product Specifications

Product Name Alternative

LIV-1/SLC39A6 Protein, Cynomolgus (sf9, His), Cynomolgus, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/liv-1-slc39a6-protein-cynomolgus-hek293-his.html

Purity

95.00

Smiles

LHELKSAAAFPQTTEKISPNWESGINVDLAITTRQYHLQQLFYRYGENNSLSVEGFRKLLQNIGIDKIKRIHIHHDHDHHSDHEHHSDHEHHSDHEHHSHRNHAASGKNKRKALCPEHDSDSSGKDPRNSQGKGAHRPEHANGRRNVKDSVSTSEVTSTVYNTVSEGTHFLETIETPKLFPKDVSSSTPPSVTEKSLVSRLAGRKTNESMSEPRKGFMYSRNTNENPQECFNASKLLTSHGMGIQVPLNATEFNYLCPAIINQIDARSCLIHTSEKKAEIPPKTYSLQI

Molecular Formula

101926643 (Gene_ID) XP_005586923 (L21-I309) (Accession)

Molecular Weight

Approximately 45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL
BNC740460-500 1x 500 µL

CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL
BNC400391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF740 conjugate, 0.1mg/mL
BNC740176-100 1x 100 µL

CD5 (Cris-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19/800), CF488A conjugate, 0.1mg/mL
BNC880800-500 1x 500 µL

Cytokeratin 19 (KRT19/800), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), 0.2mg/mL
BNUB0008-100 1x 100 µL

MAGE A1 (MA454), 0.2mg/mL

Sign In for Pricing
View Details
Myosin, Smooth Muscle Heavy Chain (SMMS-1), CF647 conjugate, 0.1mg/mL
BNC470893-100 1x 100 µL

Myosin, Smooth Muscle Heavy Chain (SMMS-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details