Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Rat

IL-1 beta is a potent proinflammatory cytokine expressed by monocytes, macrophages, and dendritic cells. IL-1 beta plays a key role in inflammation and immunologic reactions[1][2]. IL-1 beta Protein, Rat is expressed in E. coli.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-rat.html

Purity

98.0

Smiles

VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS

Molecular Formula

24494 (Gene_ID) Q63264 (V117-S268) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Jan Petrasek, et al. IL-1 receptor antagonist ameliorates inflammasome-dependent alcoholic steatohepatitis in mice. J Clin Invest. 2012 Oct;122 (10) :3476-89.|[2]Karina Zitta, et al. Interleukin-1beta regulates cell proliferation and activity of extracellular matrix remodelling enzymes in cultured primary pig heart cells. Biochem Biophys Res Commun. 2010 Sep 3;399 (4) :542-7.|[3]Kenichi Shimada, et al. Caspase-1 dependent IL-1β secretion is critical for host defense in a mouse model of Chlamydia pneumoniae lung infection. PLoS One. 2011;6 (6) :e21477.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16 (rCDH16/1071), Biotin conjugate, 0.1mg/mL
BNCB1824-100 1x 100 µL

Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16 (rCDH16/1071), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SFRP1 (N-term) Rabbit Polyclonal Antibody
AP53873PU-N 400 µL

SFRP1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Plasma/Serum Cell-Free Circulating and Viral Nucleic Acid Purification Maxi Kit
56500 10 Preparations

Plasma/Serum Cell-Free Circulating and Viral Nucleic Acid Purification Maxi Kit

Sign In for Pricing
View Details
Demephion-S
TRC-D793920-100MG 100 mg

Demephion-S

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS710944 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
2-Biphenylyl Sulfate Potassium Salt
TRC-B397895-50MG 50 mg

2-Biphenylyl Sulfate Potassium Salt

Sign In for Pricing
View Details