IL-1 beta, Rat
IL-1 beta is a potent proinflammatory cytokine expressed by monocytes, macrophages, and dendritic cells. IL-1 beta plays a key role in inflammation and immunologic reactions[1][2]. IL-1 beta Protein, Rat is expressed in E. coli.
Product Specifications
Product Name Alternative
IL-1 beta Protein, Rat, Rat, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-1-beta-protein-rat.html
Purity
98.0
Smiles
VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS
Molecular Formula
24494 (Gene_ID) Q63264 (V117-S268) (Accession)
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Jan Petrasek, et al. IL-1 receptor antagonist ameliorates inflammasome-dependent alcoholic steatohepatitis in mice. J Clin Invest. 2012 Oct;122 (10) :3476-89.|[2]Karina Zitta, et al. Interleukin-1beta regulates cell proliferation and activity of extracellular matrix remodelling enzymes in cultured primary pig heart cells. Biochem Biophys Res Commun. 2010 Sep 3;399 (4) :542-7.|[3]Kenichi Shimada, et al. Caspase-1 dependent IL-1β secretion is critical for host defense in a mouse model of Chlamydia pneumoniae lung infection. PLoS One. 2011;6 (6) :e21477.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Pan-Lactyl-lysine Recombinant Rabbit Monoclonal Antibody [PSH03-73]](https://cdn.genprice.uk/products/992/68dd1c8d061270361ea821f2/imageurl/ha722037.webp)
HA722037 100 µL
Pan-Lactyl-lysine Recombinant Rabbit Monoclonal Antibody [PSH03-73]
Sign In for Pricing
View Details 
![NAB2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E1]](https://cdn.genprice.uk/products/937/68dd1b7a061270361ea1bd6d/imageurl/ta803955bm.webp)
TA803955BM 100 µL
NAB2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E1]
Sign In for Pricing
View Details 
BNC743608-100 1x 100 µL
Langerin / CD207 (Marker of Langerhans Cells) (rLGRN/1821), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details