Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MOB4, Human (His)

The MOB4 protein may be involved in membrane trafficking, specifically the membrane budding reaction, highlighting its role in vesicle formation and trafficking.MOB4 interacts with STRN4, suggesting involvement in protein-protein interactions.MOB4 Protein, Human (His) is the recombinant human-derived MOB4 protein, expressed by E.coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MOB4 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mob4-protein-human-his.html

Purity

90.0

Smiles

MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPILEEEVQNSVSGESEA

Molecular Formula

25843 (Gene_ID) Q9Y3A3 (M1-A225) (Accession)

Molecular Weight

Approximately 29.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Yangonin
TRC-Y100550-25MG 25 mg

Yangonin

Sign In for Pricing
View Details
Cell Meter™ Fluorimetric Intracellular Nitric Oxide (NO) Activity Assay Kit *Orange Fluorescence Optimized for Flow Cytometry*
16351-AAT 100 Tests

Cell Meter™ Fluorimetric Intracellular Nitric Oxide (NO) Activity Assay Kit *Orange Fluorescence Optimized for Flow Cytometry*

Sign In for Pricing
View Details
Alpha-D-Glucoheptonic Acid Sodium Salt
TRC-G450165-50G 50 g

Alpha-D-Glucoheptonic Acid Sodium Salt

Sign In for Pricing
View Details
2-Adamantanamine Hydrochloride
TRC-A575843-50MG 50 mg

2-Adamantanamine Hydrochloride

Sign In for Pricing
View Details
LOX 1 (OLR1) (N-term) Goat Polyclonal Antibody
AP33494PU-N 100 µg

LOX 1 (OLR1) (N-term) Goat Polyclonal Antibody

Sign In for Pricing
View Details
HLA DMB (HLA-DMB) (Center) Rabbit Polyclonal Antibody
AP52052PU-N 400 µL

HLA DMB (HLA-DMB) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details