Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MOB4, Human (His)

The MOB4 protein may be involved in membrane trafficking, specifically the membrane budding reaction, highlighting its role in vesicle formation and trafficking.MOB4 interacts with STRN4, suggesting involvement in protein-protein interactions.MOB4 Protein, Human (His) is the recombinant human-derived MOB4 protein, expressed by E.coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MOB4 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mob4-protein-human-his.html

Purity

90.0

Smiles

MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPILEEEVQNSVSGESEA

Molecular Formula

25843 (Gene_ID) Q9Y3A3 (M1-A225) (Accession)

Molecular Weight

Approximately 29.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FUS (C-term) Rabbit Polyclonal Antibody
AP51735PU-N 400 µL

FUS (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Water Chiller BCHI-301
BCHI-301 Each

Water Chiller BCHI-301

Sign In for Pricing
View Details
Bcl-x (2H12), CF640R conjugate, 0.1mg/mL
BNC400751-100 1x 100 µL

Bcl-x (2H12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD4 Antibody[RM4-5]
E-AB-F1353UJ-01 25 µg

PerCP/Cyanine5.5 Anti-Mouse CD4 Antibody[RM4-5]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD4 Antibody[RM4-5]
E-AB-F1353UJ-02 100 µg

PerCP/Cyanine5.5 Anti-Mouse CD4 Antibody[RM4-5]

Sign In for Pricing
View Details
SH3GLB2 Rabbit Polyclonal Antibody
TA366731 100 µL

SH3GLB2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details