MOB4, Human (His)
The MOB4 protein may be involved in membrane trafficking, specifically the membrane budding reaction, highlighting its role in vesicle formation and trafficking.MOB4 interacts with STRN4, suggesting involvement in protein-protein interactions.MOB4 Protein, Human (His) is the recombinant human-derived MOB4 protein, expressed by E.coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
MOB4 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mob4-protein-human-his.html
Purity
90.0
Smiles
MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPILEEEVQNSVSGESEA
Molecular Formula
25843 (Gene_ID) Q9Y3A3 (M1-A225) (Accession)
Molecular Weight
Approximately 29.0 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LV786197 1.0 µg DNA
SNX19P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details 
abx461836-01 100 µg
Sudan Ebolavirus Rna-Directed Rna Polymerase L (SUDV L) Antibody
Sign In for Pricing
View Details abx461836-02 1 mg
Sudan Ebolavirus Rna-Directed Rna Polymerase L (SUDV L) Antibody
Sign In for Pricing
View Details