Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-1, Rat (HEK293)

The IgG3 Fc protein is the constant region of an immunoglobulin heavy chain that acts as a receptor for a specific antigen. TIMP-1 Protein, Rat (HEK293) is the recombinant rat-derived TIMP-1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

TIMP-1 Protein, Rat (HEK293), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-1-protein-rat-hek293.html

Purity

95.0

Smiles

ASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNA

Molecular Formula

116510 (Gene_ID) P30120/NP_446271.1 (C24-A217) (Accession)

Molecular Weight

Approximately 28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PI3Kd Human
OM299487-01 1 µg

PI3Kd Human

Sign In for Pricing
View Details
PI3Kd Human
OM299487-02 5 µg

PI3Kd Human

Sign In for Pricing
View Details
PI3Kd Human
OM299487-03 10 µg

PI3Kd Human

Sign In for Pricing
View Details
SEN2 sgRNA CRISPR Lentivector (Human) (Target 3)
K2118004 1.0 µg DNA

SEN2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
1,3,5-Triazine, 2-chloro-4-phenyl-6-[4- (4-phenyl-1-naphthalenyl) phenyl]-
JH918721 1 Each

1,3,5-Triazine, 2-chloro-4-phenyl-6-[4- (4-phenyl-1-naphthalenyl) phenyl]-

Sign In for Pricing
View Details
Anti-CD26/DPP4 (YS110) Biosimilar (Monoclonal, IgG)
A135845 100 µL

Anti-CD26/DPP4 (YS110) Biosimilar (Monoclonal, IgG)

Sign In for Pricing
View Details