Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-1, Rat (HEK293)

The IgG3 Fc protein is the constant region of an immunoglobulin heavy chain that acts as a receptor for a specific antigen. TIMP-1 Protein, Rat (HEK293) is the recombinant rat-derived TIMP-1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

TIMP-1 Protein, Rat (HEK293), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-1-protein-rat-hek293.html

Purity

95.0

Smiles

ASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNA

Molecular Formula

116510 (Gene_ID) P30120/NP_446271.1 (C24-A217) (Accession)

Molecular Weight

Approximately 28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trak1 Mouse qPCR Primer Pair (NM_175114)
MP217084 200 Reactions

Trak1 Mouse qPCR Primer Pair (NM_175114)

Sign In for Pricing
View Details
GRB2 Antibody [Biotin Conjugate]
R35139BTN 100 µg

GRB2 Antibody [Biotin Conjugate]

Sign In for Pricing
View Details
Bmi1 Rabbit mAb
E45R12802N-50 50 µL

Bmi1 Rabbit mAb

Sign In for Pricing
View Details
(KO Validated) NF-kB p65 Polyclonal Antibody
E-AB-93366-01 60 µL

(KO Validated) NF-kB p65 Polyclonal Antibody

Sign In for Pricing
View Details
(KO Validated) NF-kB p65 Polyclonal Antibody
E-AB-93366-02 120 µL

(KO Validated) NF-kB p65 Polyclonal Antibody

Sign In for Pricing
View Details
(KO Validated) NF-kB p65 Polyclonal Antibody
E-AB-93366-03 200 µL

(KO Validated) NF-kB p65 Polyclonal Antibody

Sign In for Pricing
View Details