Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-1, Rat (HEK293)

The IgG3 Fc protein is the constant region of an immunoglobulin heavy chain that acts as a receptor for a specific antigen. TIMP-1 Protein, Rat (HEK293) is the recombinant rat-derived TIMP-1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

TIMP-1 Protein, Rat (HEK293), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-1-protein-rat-hek293.html

Purity

95.0

Smiles

ASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNA

Molecular Formula

116510 (Gene_ID) P30120/NP_446271.1 (C24-A217) (Accession)

Molecular Weight

Approximately 28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRKAG3 Antibody
A69837-50UL 50 μL

PRKAG3 Antibody

Sign In for Pricing
View Details
bcl 6 (BCL6) (NM_001706) Human Tagged ORF Clone
RG219007 10 µg

bcl 6 (BCL6) (NM_001706) Human Tagged ORF Clone

Sign In for Pricing
View Details
ATR (ataxia Telangiectasia and Rad3 Related, FRP1, MEC1, SCKL, SCKL1) (AP) discontinued
243654-AP 100 µL

ATR (ataxia Telangiectasia and Rad3 Related, FRP1, MEC1, SCKL, SCKL1) (AP) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal ARID1A Antibody [Alexa Fluor 647]
NB100-55334AF647 0.1 mL

Rabbit Polyclonal ARID1A Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
ZMYM2 Adenovirus (Mouse)
51275054 1.0 mL

ZMYM2 Adenovirus (Mouse)

Sign In for Pricing
View Details
LCL-161 10mM * 1mL in DMSO
A11928-10mM-D 10 mM x 1mL in DMSO

LCL-161 10mM * 1mL in DMSO

Sign In for Pricing
View Details