Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-1, Rat (HEK293)

The IgG3 Fc protein is the constant region of an immunoglobulin heavy chain that acts as a receptor for a specific antigen. TIMP-1 Protein, Rat (HEK293) is the recombinant rat-derived TIMP-1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

TIMP-1 Protein, Rat (HEK293), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-1-protein-rat-hek293.html

Purity

95.0

Smiles

ASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNA

Molecular Formula

116510 (Gene_ID) P30120/NP_446271.1 (C24-A217) (Accession)

Molecular Weight

Approximately 28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TFIP11 Antibody
NBP1-40364 0.1 mL

Rabbit Polyclonal TFIP11 Antibody

Sign In for Pricing
View Details
TUBG1, NT (TUBG1, TUBG, Tubulin gamma-1 chain, Gamma-1-tubulin, Gamma-tubulin complex component 1) (MaxLight 405)
MBS6360216-01 0.1 mL

TUBG1, NT (TUBG1, TUBG, Tubulin gamma-1 chain, Gamma-1-tubulin, Gamma-tubulin complex component 1) (MaxLight 405)

Sign In for Pricing
View Details
TUBG1, NT (TUBG1, TUBG, Tubulin gamma-1 chain, Gamma-1-tubulin, Gamma-tubulin complex component 1) (MaxLight 405)
MBS6360216-02 5x 0.1 mL

TUBG1, NT (TUBG1, TUBG, Tubulin gamma-1 chain, Gamma-1-tubulin, Gamma-tubulin complex component 1) (MaxLight 405)

Sign In for Pricing
View Details
PTPLB (Protein Tyrosine Phosphatase-like (Proline instead of Catalytic Arginine), Member b) (MaxLight 405)
MBS6451481-01 0.1 mL

PTPLB (Protein Tyrosine Phosphatase-like (Proline instead of Catalytic Arginine), Member b) (MaxLight 405)

Sign In for Pricing
View Details
PTPLB (Protein Tyrosine Phosphatase-like (Proline instead of Catalytic Arginine), Member b) (MaxLight 405)
MBS6451481-02 5x 0.1 mL

PTPLB (Protein Tyrosine Phosphatase-like (Proline instead of Catalytic Arginine), Member b) (MaxLight 405)

Sign In for Pricing
View Details
Lentiviral mouse Mpig6b shRNA (UAS) - Lentiviral mouse Mpig6b shRNA (UAS, iRFP) plasmid
GTR15289972 1 Vial

Lentiviral mouse Mpig6b shRNA (UAS) - Lentiviral mouse Mpig6b shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details