TIMP-1, Rat (HEK293)
The IgG3 Fc protein is the constant region of an immunoglobulin heavy chain that acts as a receptor for a specific antigen. TIMP-1 Protein, Rat (HEK293) is the recombinant rat-derived TIMP-1 protein, expressed by HEK293 , with tag free.
Product Specifications
Product Name Alternative
TIMP-1 Protein, Rat (HEK293), Rat, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/timp-1-protein-rat-hek293.html
Purity
95.0
Smiles
ASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNA
Molecular Formula
116510 (Gene_ID) P30120/NP_446271.1 (C24-A217) (Accession)
Molecular Weight
Approximately 28 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
K7573008 1.0 µg DNA
Tgfb1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
Sign In for Pricing
View Details 
MBS8102707-02 5x 0.1 mL
Anti-DcR2/TRAIL R4 Antibody, Mouse Monoclonal
Sign In for Pricing
View Details 
TL706047V 500 µL Each
Cxcl17 Rat shRNA Lentiviral Particle (Locus ID 308436)
Sign In for Pricing
View Details MP0363J Each
Magic™ Membrane Protein Human SUSD1 (Sushi domain containing 1) for Antibody Discovery
Sign In for Pricing
View Details 125846-AP 100 µL
Dihydropyrimidine Dehydrogenase (DPD, DPYD, DHP, DHPDHase, Dihydrothymine Dehydrogenase, Dihydrouracil Dehydrogenase, MGC70799, MGC132008) (AP) discontinued
Sign In for Pricing
View Details