TIMP-1, Rat (HEK293)
The IgG3 Fc protein is the constant region of an immunoglobulin heavy chain that acts as a receptor for a specific antigen. TIMP-1 Protein, Rat (HEK293) is the recombinant rat-derived TIMP-1 protein, expressed by HEK293 , with tag free.
Product Specifications
Product Name Alternative
TIMP-1 Protein, Rat (HEK293), Rat, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/timp-1-protein-rat-hek293.html
Purity
95.0
Smiles
ASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNA
Molecular Formula
116510 (Gene_ID) P30120/NP_446271.1 (C24-A217) (Accession)
Molecular Weight
Approximately 28 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
039491-APC 200 µL
OR8K1, CT (OR8K1, Olfactory receptor 8K1, Olfactory receptor OR11-182) (APC) discontinued
Sign In for Pricing
View Details 
VAng-Wyb2804-500gEcoli 500 µg (E. coli)
Recombinant Neisseria Gonorrhoeae rpsL Protein (aa 1-123)
Sign In for Pricing
View Details MR224021L3V 200 µL
Coro6 (NM_139130) Mouse Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details MBS7231638-01 48 Well
Rabbit Olfactory receptor 2M2 (OR2M2) ELISA Kit
Sign In for Pricing
View Details 
MBS7231638-02 96 Well
Rabbit Olfactory receptor 2M2 (OR2M2) ELISA Kit
Sign In for Pricing
View Details MBS7231638-03 5x 96 Well
Rabbit Olfactory receptor 2M2 (OR2M2) ELISA Kit
Sign In for Pricing
View Details