Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-1, Rat (HEK293)

The IgG3 Fc protein is the constant region of an immunoglobulin heavy chain that acts as a receptor for a specific antigen. TIMP-1 Protein, Rat (HEK293) is the recombinant rat-derived TIMP-1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

TIMP-1 Protein, Rat (HEK293), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-1-protein-rat-hek293.html

Purity

95.0

Smiles

ASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNA

Molecular Formula

116510 (Gene_ID) P30120/NP_446271.1 (C24-A217) (Accession)

Molecular Weight

Approximately 28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR97 (ADGRG3) (NM_170776) Human Tagged ORF Clone Lentiviral Particle
RC209104L4V 200 µL

GPR97 (ADGRG3) (NM_170776) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti-LIN7C antibody
PAab04790 100 µg

Anti-LIN7C antibody

Sign In for Pricing
View Details
AMPK γ1 Rabbit Poloclonal Anbtibody(F115)
RA20273-01 50 µL

AMPK γ1 Rabbit Poloclonal Anbtibody(F115)

Sign In for Pricing
View Details
AMPK γ1 Rabbit Poloclonal Anbtibody(F115)
RA20273-02 100 µL

AMPK γ1 Rabbit Poloclonal Anbtibody(F115)

Sign In for Pricing
View Details
Anti-FLJ11184  (4A6)
YF-MA18768 100 ug

Anti-FLJ11184 (4A6)

Sign In for Pricing
View Details
Rabbit anti-ZNF318/TZF Antibody, Affinity Purified
MBS3902026-01 0.01 mg

Rabbit anti-ZNF318/TZF Antibody, Affinity Purified

Sign In for Pricing
View Details