Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-1, Rat (HEK293)

The IgG3 Fc protein is the constant region of an immunoglobulin heavy chain that acts as a receptor for a specific antigen. TIMP-1 Protein, Rat (HEK293) is the recombinant rat-derived TIMP-1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

TIMP-1 Protein, Rat (HEK293), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-1-protein-rat-hek293.html

Purity

95.0

Smiles

ASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNA

Molecular Formula

116510 (Gene_ID) P30120/NP_446271.1 (C24-A217) (Accession)

Molecular Weight

Approximately 28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EHF sgRNA CRISPR Lentivector set (Human)
K0663501 3x 1.0 µg

EHF sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Map4k5 3'UTR GFP Stable Cell Line
TU262841 1.0 mL

Map4k5 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Tmem217 (NM_001162901) Mouse Tagged ORF Clone Lentiviral Particle
MR214995L4V 200 µL

Tmem217 (NM_001162901) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rat CYB561A3 shRNA Plasmid
abx990257-01 150 µg

Rat CYB561A3 shRNA Plasmid

Sign In for Pricing
View Details
Rat CYB561A3 shRNA Plasmid
abx990257-02 300 µg

Rat CYB561A3 shRNA Plasmid

Sign In for Pricing
View Details
(±) -Pantothenic acid
MF-0035608-01 5 mg

(±) -Pantothenic acid

Sign In for Pricing
View Details