Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-1, Rat (HEK293)

The IgG3 Fc protein is the constant region of an immunoglobulin heavy chain that acts as a receptor for a specific antigen. TIMP-1 Protein, Rat (HEK293) is the recombinant rat-derived TIMP-1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

TIMP-1 Protein, Rat (HEK293), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-1-protein-rat-hek293.html

Purity

95.0

Smiles

ASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNA

Molecular Formula

116510 (Gene_ID) P30120/NP_446271.1 (C24-A217) (Accession)

Molecular Weight

Approximately 28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GGA2 (NM_015044) Human Recombinant Protein
TP300153L 1 mg

GGA2 (NM_015044) Human Recombinant Protein

Sign In for Pricing
View Details
Adiponectin (ADIPOQ) rabbit polyclonal antibody, Aff - Purified
AP07653PU-N 50 µg

Adiponectin (ADIPOQ) rabbit polyclonal antibody, Aff - Purified

Sign In for Pricing
View Details
Anti-FKBP1A Rabbit Monoclonal Antibody
1985-01 20 μL

Anti-FKBP1A Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-FKBP1A Rabbit Monoclonal Antibody
1985-02 100 μL

Anti-FKBP1A Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CNDP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV702665 1.0 µg DNA

CNDP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Zfp622 (NM_001009652) Rat Tagged ORF Clone Lentiviral Particle
RR213197L4V 200 µL

Zfp622 (NM_001009652) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details