Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-1, Rat (HEK293)

The IgG3 Fc protein is the constant region of an immunoglobulin heavy chain that acts as a receptor for a specific antigen. TIMP-1 Protein, Rat (HEK293) is the recombinant rat-derived TIMP-1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

TIMP-1 Protein, Rat (HEK293), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-1-protein-rat-hek293.html

Purity

95.0

Smiles

ASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNA

Molecular Formula

116510 (Gene_ID) P30120/NP_446271.1 (C24-A217) (Accession)

Molecular Weight

Approximately 28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Attractin ATM ELISA Kit
BG-HUM10007 1 Each

Human Attractin ATM ELISA Kit

Sign In for Pricing
View Details
SERPINC1 (SERPINC1, AT3, Antithrombin-III, Serpin C1) (MaxLight 750) discontinued
031245-ML750 100 µL

SERPINC1 (SERPINC1, AT3, Antithrombin-III, Serpin C1) (MaxLight 750) discontinued

Sign In for Pricing
View Details
MN1 Human siRNA Oligo Duplex (Locus ID 4330)
SR302940 1 Kit

MN1 Human siRNA Oligo Duplex (Locus ID 4330)

Sign In for Pricing
View Details
Map3k7 Mouse Gene Knockout Kit (CRISPR)
KN309739 1 Kit

Map3k7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rabbit anti-Staphylococcus aureus pbp Polyclonal Antibody
MBS7164732 Inquire

Rabbit anti-Staphylococcus aureus pbp Polyclonal Antibody

Sign In for Pricing
View Details
Caspase 9 Rabbit Monoclonal Antibody
AMRe04119-01 1 Each

Caspase 9 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details