Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-1, Rat (HEK293)

The IgG3 Fc protein is the constant region of an immunoglobulin heavy chain that acts as a receptor for a specific antigen. TIMP-1 Protein, Rat (HEK293) is the recombinant rat-derived TIMP-1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

TIMP-1 Protein, Rat (HEK293), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-1-protein-rat-hek293.html

Purity

95.0

Smiles

ASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNA

Molecular Formula

116510 (Gene_ID) P30120/NP_446271.1 (C24-A217) (Accession)

Molecular Weight

Approximately 28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ZSCAN4 shRNA (UAS) - Lentiviral human ZSCAN4 shRNA (UAS) (25)
GTR15345644 1 Vial

Lentiviral human ZSCAN4 shRNA (UAS) - Lentiviral human ZSCAN4 shRNA (UAS) (25)

Sign In for Pricing
View Details
Human TIMELESS Pre-designed siRNA Set B
SI016647B 1 Each

Human TIMELESS Pre-designed siRNA Set B

Sign In for Pricing
View Details
Ccnb3 (NM_183015) Mouse Untagged Clone
MC224404 10 µg

Ccnb3 (NM_183015) Mouse Untagged Clone

Sign In for Pricing
View Details
Parainfluenza Type 2 (Parainfluenza Virus Type 2, Parainfluenza 2) (PE)
MBS6263129-01 0.1 mL

Parainfluenza Type 2 (Parainfluenza Virus Type 2, Parainfluenza 2) (PE)

Sign In for Pricing
View Details
Parainfluenza Type 2 (Parainfluenza Virus Type 2, Parainfluenza 2) (PE)
MBS6263129-02 5x 0.1 mL

Parainfluenza Type 2 (Parainfluenza Virus Type 2, Parainfluenza 2) (PE)

Sign In for Pricing
View Details
Neurofilament M, 160kD (NF-M) (HRP)
MBS6258729-01 0.1 mL

Neurofilament M, 160kD (NF-M) (HRP)

Sign In for Pricing
View Details