Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-1, Rat (HEK293)

The IgG3 Fc protein is the constant region of an immunoglobulin heavy chain that acts as a receptor for a specific antigen. TIMP-1 Protein, Rat (HEK293) is the recombinant rat-derived TIMP-1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

TIMP-1 Protein, Rat (HEK293), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-1-protein-rat-hek293.html

Purity

95.0

Smiles

ASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNA

Molecular Formula

116510 (Gene_ID) P30120/NP_446271.1 (C24-A217) (Accession)

Molecular Weight

Approximately 28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIMM10 (NM_012456) Human Tagged Lenti ORF Clone
RC205668L3 10 µg

TIMM10 (NM_012456) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SRGAP2 Rabbit pAb
A9523 100 µL

SRGAP2 Rabbit pAb

Sign In for Pricing
View Details
Boc-Aminooxy-PEG2-bromide
HY-135962 1 Each

Boc-Aminooxy-PEG2-bromide

Sign In for Pricing
View Details
Keratin 7 (BSA & Azide Free) (MaxLight 490)
MBS6267466-01 0.1 mL

Keratin 7 (BSA & Azide Free) (MaxLight 490)

Sign In for Pricing
View Details
Keratin 7 (BSA & Azide Free) (MaxLight 490)
MBS6267466-02 5x 0.1 mL

Keratin 7 (BSA & Azide Free) (MaxLight 490)

Sign In for Pricing
View Details
Human Endothelin 2, ET-2 ELISA KIT
E3204Hu-01 48 Well

Human Endothelin 2, ET-2 ELISA KIT

Sign In for Pricing
View Details