Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-1, Rat (HEK293)

The IgG3 Fc protein is the constant region of an immunoglobulin heavy chain that acts as a receptor for a specific antigen. TIMP-1 Protein, Rat (HEK293) is the recombinant rat-derived TIMP-1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

TIMP-1 Protein, Rat (HEK293), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-1-protein-rat-hek293.html

Purity

95.0

Smiles

ASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNA

Molecular Formula

116510 (Gene_ID) P30120/NP_446271.1 (C24-A217) (Accession)

Molecular Weight

Approximately 28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNNI1 Rabbit mAb
RDSA65825 100 µL

TNNI1 Rabbit mAb

Sign In for Pricing
View Details
UBE2R2 Protein (N-His, Human)
P509431 100 µg

UBE2R2 Protein (N-His, Human)

Sign In for Pricing
View Details
Acetyl-L-homoserine lactone
HY-W243002-01 5 mg

Acetyl-L-homoserine lactone

Sign In for Pricing
View Details
Acetyl-L-homoserine lactone
HY-W243002-02 10 mg

Acetyl-L-homoserine lactone

Sign In for Pricing
View Details
Acetyl-L-homoserine lactone
HY-W243002-03 25 mg

Acetyl-L-homoserine lactone

Sign In for Pricing
View Details
Phospho-C-Myc (Ser373) Polyclonal Antibody, PE Conjugated
bs-8442R-PE 100 µL

Phospho-C-Myc (Ser373) Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details