TIMP-1, Rat (HEK293)
The IgG3 Fc protein is the constant region of an immunoglobulin heavy chain that acts as a receptor for a specific antigen. TIMP-1 Protein, Rat (HEK293) is the recombinant rat-derived TIMP-1 protein, expressed by HEK293 , with tag free.
Product Specifications
Product Name Alternative
TIMP-1 Protein, Rat (HEK293), Rat, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/timp-1-protein-rat-hek293.html
Purity
95.0
Smiles
ASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNA
Molecular Formula
116510 (Gene_ID) P30120/NP_446271.1 (C24-A217) (Accession)
Molecular Weight
Approximately 28 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6415717-01 0.1 mL
ELK1 (ETS Domain-containing Protein Elk-1, NBN, ATV, P95, FLJ10155, NBS1) (APC)
Sign In for Pricing
View Details 
MBS6415717-02 5x 0.1 mL
ELK1 (ETS Domain-containing Protein Elk-1, NBN, ATV, P95, FLJ10155, NBS1) (APC)
Sign In for Pricing
View Details 
133132-ML750 100 µL
SEPT2 (Septin-2, Neural Precursor Cell Expressed Developmentally Down-regulated Protein 5, NEDD-5, DIFF6, KIAA0158, NEDD5) (MaxLight 750) discontinued
Sign In for Pricing
View Details