Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-1, Rat (HEK293)

The IgG3 Fc protein is the constant region of an immunoglobulin heavy chain that acts as a receptor for a specific antigen. TIMP-1 Protein, Rat (HEK293) is the recombinant rat-derived TIMP-1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

TIMP-1 Protein, Rat (HEK293), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-1-protein-rat-hek293.html

Purity

95.0

Smiles

ASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNA

Molecular Formula

116510 (Gene_ID) P30120/NP_446271.1 (C24-A217) (Accession)

Molecular Weight

Approximately 28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ltbr (NM_010736) Mouse Tagged Lenti ORF Clone
MR225386L4 10 µg

Ltbr (NM_010736) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
FCGR1B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0769208 1.0 µg DNA

FCGR1B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Fragile X Mental Retardation 1 (FMR1) Antibody (Biotin)
abx243137 Inquire

Fragile X Mental Retardation 1 (FMR1) Antibody (Biotin)

Sign In for Pricing
View Details
Ndufv2 Rat Pre-designed siRNA Set A
HY-RS27680 1 Set

Ndufv2 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
Core Histone Macro-H2A.1 (MACROH2A1) Antibody
abx376978-01 50 µg

Core Histone Macro-H2A.1 (MACROH2A1) Antibody

Sign In for Pricing
View Details
Core Histone Macro-H2A.1 (MACROH2A1) Antibody
abx376978-02 100 µg

Core Histone Macro-H2A.1 (MACROH2A1) Antibody

Sign In for Pricing
View Details