Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-1, Rat (HEK293)

The IgG3 Fc protein is the constant region of an immunoglobulin heavy chain that acts as a receptor for a specific antigen. TIMP-1 Protein, Rat (HEK293) is the recombinant rat-derived TIMP-1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

TIMP-1 Protein, Rat (HEK293), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-1-protein-rat-hek293.html

Purity

95.0

Smiles

ASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNA

Molecular Formula

116510 (Gene_ID) P30120/NP_446271.1 (C24-A217) (Accession)

Molecular Weight

Approximately 28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-chloro-N- (2,3,5,6-tetrachlorophenyl) acetamide
sc-274617 1 g

2-chloro-N- (2,3,5,6-tetrachlorophenyl) acetamide

Sign In for Pricing
View Details
LEPREL1 (P3H2) (NM_001134418) Human Tagged ORF Clone
RC225901 10 µg

LEPREL1 (P3H2) (NM_001134418) Human Tagged ORF Clone

Sign In for Pricing
View Details
KRT19 Antibody
K16229U01G06C-01 50 ug

KRT19 Antibody

Sign In for Pricing
View Details
KRT19 Antibody
K16229U01G06C-02 100 ug

KRT19 Antibody

Sign In for Pricing
View Details
KRT19 Antibody
K16229U01G06C-03 1 mg

KRT19 Antibody

Sign In for Pricing
View Details
Bovine Low affinity immunoglobulin gamma Fc region receptor II-a (FCGR2A) ELISA Kit
OM618047 96 Strip Well

Bovine Low affinity immunoglobulin gamma Fc region receptor II-a (FCGR2A) ELISA Kit

Sign In for Pricing
View Details