Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-1, Rat (HEK293)

The IgG3 Fc protein is the constant region of an immunoglobulin heavy chain that acts as a receptor for a specific antigen. TIMP-1 Protein, Rat (HEK293) is the recombinant rat-derived TIMP-1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

TIMP-1 Protein, Rat (HEK293), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-1-protein-rat-hek293.html

Purity

95.0

Smiles

ASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNA

Molecular Formula

116510 (Gene_ID) P30120/NP_446271.1 (C24-A217) (Accession)

Molecular Weight

Approximately 28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Methoxy-5-methyl-γ-phenylbenzenepropanol Methanesulfonate
418590-01 500 mg

2-Methoxy-5-methyl-γ-phenylbenzenepropanol Methanesulfonate

Sign In for Pricing
View Details
2-Methoxy-5-methyl-γ-phenylbenzenepropanol Methanesulfonate
418590-02 5 g

2-Methoxy-5-methyl-γ-phenylbenzenepropanol Methanesulfonate

Sign In for Pricing
View Details
Mouse Monoclonal MEF2B Antibody (PCRP-MEF2B-2F9) [Allophycocyanin]
NBP3-14207APC 0.1 mL

Mouse Monoclonal MEF2B Antibody (PCRP-MEF2B-2F9) [Allophycocyanin]

Sign In for Pricing
View Details
Anti-FcGR3A-Anti-EGFR Bispecific Antibody
101535 50 µg

Anti-FcGR3A-Anti-EGFR Bispecific Antibody

Sign In for Pricing
View Details
ERGIC1 (NM_020462) Human Tagged Lenti ORF Clone
RC222998L4 10 µg

ERGIC1 (NM_020462) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human ARF3 Protein Lysate
MBS137433-01 0.02 mg

Human ARF3 Protein Lysate

Sign In for Pricing
View Details