Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-1, Rat (HEK293)

The IgG3 Fc protein is the constant region of an immunoglobulin heavy chain that acts as a receptor for a specific antigen. TIMP-1 Protein, Rat (HEK293) is the recombinant rat-derived TIMP-1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

TIMP-1 Protein, Rat (HEK293), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-1-protein-rat-hek293.html

Purity

95.0

Smiles

ASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNA

Molecular Formula

116510 (Gene_ID) P30120/NP_446271.1 (C24-A217) (Accession)

Molecular Weight

Approximately 28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ywhae shRNA (UAS) - Lentiviral mouse Ywhae shRNA (UAS, GFP) (100)
GTR15275985 1 Vial

Lentiviral mouse Ywhae shRNA (UAS) - Lentiviral mouse Ywhae shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Anti-TG beta RIII antibody
STJ95996 200 µl

Anti-TG beta RIII antibody

Sign In for Pricing
View Details
Pigeon Netrin Receptor DCC (DCC) ELISA Kit
MBS9908259 Inquire

Pigeon Netrin Receptor DCC (DCC) ELISA Kit

Sign In for Pricing
View Details
Slc25a32 sgRNA CRISPR Lentivector set (Mouse)
K3473001 3x 1.0 µg

Slc25a32 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Anti-APRIL (zigakibart biosimilar) mAb
MBS1881912-01 0.05 mg

Anti-APRIL (zigakibart biosimilar) mAb

Sign In for Pricing
View Details
Anti-APRIL (zigakibart biosimilar) mAb
MBS1881912-02 0.1 mg

Anti-APRIL (zigakibart biosimilar) mAb

Sign In for Pricing
View Details