Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-1, Rat (HEK293)

The IgG3 Fc protein is the constant region of an immunoglobulin heavy chain that acts as a receptor for a specific antigen. TIMP-1 Protein, Rat (HEK293) is the recombinant rat-derived TIMP-1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

TIMP-1 Protein, Rat (HEK293), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-1-protein-rat-hek293.html

Purity

95.0

Smiles

ASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNA

Molecular Formula

116510 (Gene_ID) P30120/NP_446271.1 (C24-A217) (Accession)

Molecular Weight

Approximately 28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAMHD1 (NM_015474) Human Tagged ORF Clone
RC206013 10 µg

SAMHD1 (NM_015474) Human Tagged ORF Clone

Sign In for Pricing
View Details
KDM3B Polyclonal Antibody
RD252091A-01 20 µL

KDM3B Polyclonal Antibody

Sign In for Pricing
View Details
KDM3B Polyclonal Antibody
RD252091A-02 60 μL

KDM3B Polyclonal Antibody

Sign In for Pricing
View Details
KDM3B Polyclonal Antibody
RD252091A-03 120 μL

KDM3B Polyclonal Antibody

Sign In for Pricing
View Details
KDM3B Polyclonal Antibody
RD252091A-04 200 µL

KDM3B Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Uncharacterized protein YFR032C-B (YFR032C-B)
MBS7039965-01 0.02 mg

Recombinant Saccharomyces cerevisiae Uncharacterized protein YFR032C-B (YFR032C-B)

Sign In for Pricing
View Details