Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-1, Rat (HEK293)

The IgG3 Fc protein is the constant region of an immunoglobulin heavy chain that acts as a receptor for a specific antigen. TIMP-1 Protein, Rat (HEK293) is the recombinant rat-derived TIMP-1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

TIMP-1 Protein, Rat (HEK293), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-1-protein-rat-hek293.html

Purity

95.0

Smiles

ASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNA

Molecular Formula

116510 (Gene_ID) P30120/NP_446271.1 (C24-A217) (Accession)

Molecular Weight

Approximately 28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Actl7a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3022505 3x 1.0 µg

Actl7a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Mouse Monoclonal Teprotumumab Antibody (975547) [Alexa Fluor 532]
FAB96341X 0.1 mL

Mouse Monoclonal Teprotumumab Antibody (975547) [Alexa Fluor 532]

Sign In for Pricing
View Details
Wnk2 (NM_001290311) Mouse Untagged Clone
MC229721 10 µg

Wnk2 (NM_001290311) Mouse Untagged Clone

Sign In for Pricing
View Details
Dodecanoic-D23 Acid
MBS393914-01 100 mg

Dodecanoic-D23 Acid

Sign In for Pricing
View Details
Dodecanoic-D23 Acid
MBS393914-02 500 mg

Dodecanoic-D23 Acid

Sign In for Pricing
View Details
Dodecanoic-D23 Acid
MBS393914-03 1 g

Dodecanoic-D23 Acid

Sign In for Pricing
View Details