Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GCP-2/CXCL6, Human (HEK293, His)

CXCL6 (also known as granulocyte chemotactic protein-2, GCP-2), a member of the ELR+ CXC chemokine family, is a chemoattractant for neutrophilic granulocytes and initiates chemotaxis through the chemokine receptors CXCR1 and CXCR2[1][2]. CXCL6 exerts neutrophil-activating and angiogenic activities, and has antibacterial action against Gram-negative and Gram-positive bacteria[3]. GCP-2/CXCL6 Protein, Human (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 77 amino acids (G38-N114) .

Product Specifications

Product Name Alternative

GCP-2/CXCL6 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gcp-2-cxcl6-protein-human-hek-293-his.html

Purity

98.0

Smiles

GPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN

Molecular Formula

6372 (Gene_ID) P80162 (G38-N114) (Accession)

Molecular Weight

Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Pooja Mittal, et al. CXCL6 (granulocyte chemotactic protein-2) : a novel chemokine involved in the innate immune response of the amniotic cavity. Am J Reprod Immunol. 2008 Sep;60 (3) :246-57.|[2]Xiaolin Wang, et al. CXCL6 regulates cell permeability, proliferation, and apoptosis after ischemia-reperfusion injury by modulating Sirt3 expression via AKT/FOXO3a activation. Cancer Biol Ther. 2021 Jan 2;22 (1) :30-39. |[3]Helena M Linge, et al. The human CXC chemokine granulocyte chemotactic protein 2 (GCP-2) /CXCL6 possesses membrane-disrupting properties and is antibacterial. Antimicrob Agents Chemother. 2008 Jul;52 (7) :2599-607.|[4]Jia-Chi Ma, et al. Fibroblast-derived CXCL12/SDF-1α promotes CXCL6 secretion and co-operatively enhances metastatic potential through the PI3K/Akt/mTOR pathway in colon cancer. World J Gastroenterol. 2017 Jul 28;23 (28) :5167-5178.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL
BNC470266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF405S conjugate, 0.1mg/mL
BNC041052-500 1x 500 µL

CD3e (B-B12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF640R conjugate, 0.1mg/mL
BNC400338-100 1x 100 µL

P53 (PAb122), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL
BNC470043-500 1x 500 µL

P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF740 conjugate, 0.1mg/mL
BNC740040-500 1x 500 µL

CD35 / CR1 (E11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF647 conjugate, 0.1mg/mL
BNC470175-100 1x 100 µL

CD46 (122.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details