Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TDGF1, Human (HEK293, Fc)

The TDGF1 protein is a GPI-anchored cell membrane protein involved in Nodal signaling. TDGF1 Protein, Human (HEK293, Fc) is the recombinant human-derived TDGF1 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TDGF1 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tdgf1-protein-human-hek-293-fc.html

Purity

95.0

Smiles

LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPS

Molecular Formula

6997 (Gene_ID) P13385 (L31-S169) (Accession)

Molecular Weight

Approximately 40-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITGA3 Antibody - middle region
MBS3221468-01 0.1 mL

ITGA3 Antibody - middle region

Sign In for Pricing
View Details
ITGA3 Antibody - middle region
MBS3221468-02 5x 0.1 mL

ITGA3 Antibody - middle region

Sign In for Pricing
View Details
RN-tre Polyclonal Antibody
MBS8525139-01 0.1 mg

RN-tre Polyclonal Antibody

Sign In for Pricing
View Details
RN-tre Polyclonal Antibody
MBS8525139-02 0.1 mL (AF635)

RN-tre Polyclonal Antibody

Sign In for Pricing
View Details
RN-tre Polyclonal Antibody
MBS8525139-03 0.1 mL (AF610)

RN-tre Polyclonal Antibody

Sign In for Pricing
View Details
RN-tre Polyclonal Antibody
MBS8525139-04 0.1 mL (AF405S)

RN-tre Polyclonal Antibody

Sign In for Pricing
View Details