Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin D, Mouse (HEK293, His)

Cathepsin D Protein, Mouse (HEK293, His) is an approximately 56.0 kDa mouse cathepsin D with a His tag. Cathepsin D is a lysosomal aspartic protease of the pepsin family[1].

Product Specifications

Product Name Alternative

Cathepsin D Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-d-protein-mouse-hek293-his.html

Purity

99.00

Smiles

IIRIPLRKFTSIRRTMTEVGGSVEDLILKGPITKYSMQSSPKTTEPVSELLKNYLDAQYYGDIGIGTPPQCFTVVFDTGSSNLWVPSIHCKILDIACWVHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSDQSKARGIKVEKQIFGEATKQPGIVFVAAKFDGILGMGYPHISVNNVLPVFDNLMQQKLVDKNIFSFYLNRDPEGQPGGELMLGGTDSKYYHGELSYLNVTRKAYWQVHMDQLEVGNELTLCKGGCEAIVDTGTSLLVGPVEEVKELQKAIGAVPLIQGEYMIPCEKVSSLPTVYLKLGGKNYELHPDKYILKVSQGGKTICLSGFMGMDIPPPSGPLWILGDVFIGSYYTVFDRDNNRVGFANAVVLHHHHHH

Molecular Formula

13033 (Gene_ID) P18242 (I21-L410) (Accession)

Molecular Weight

Approximately 46 kDa

References & Citations

[1]H Rochefort, et al.Cathepsin D in breast cancer: mechanisms and clinical applications, a 1999 overview. Clin Chim Acta. 2000 Feb 15;291 (2) :157-70.|[2]T Tsukuba, et al. New functional aspects of cathepsin D and cathepsin E. Mol Cells

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

STAT5a protein
MBS8526829-01 0.02 mg

STAT5a protein

Ask
View Details
STAT5a protein
MBS8526829-02 5x 0.02 mg

STAT5a protein

Ask
View Details
Xpress™ Human C16ORF93 Over-expressing Stable Cell Line
ABC-X0358 1 Vial

Xpress™ Human C16ORF93 Over-expressing Stable Cell Line

Ask
View Details
Grm2 (NM_001160353) Mouse Tagged ORF Clone Lentiviral Particle
MR225914L3V 200 µL

Grm2 (NM_001160353) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
NOS III, Phosphorylated (Nitric Oxide Synthase 3, Nitric Oxide Synthase 3 Endothelial Cell, NOS Type III, NOS3, Endothelial Nitric Oxide Synthase 3, Endothelial NOS, eNOS, ECNOS, EC-NOS, Constitutive NOS, cNOS, Nitric Oxide Synthase Endothelial) (HRP)
MBS6474018-01 0.1 mL

NOS III, Phosphorylated (Nitric Oxide Synthase 3, Nitric Oxide Synthase 3 Endothelial Cell, NOS Type III, NOS3, Endothelial Nitric Oxide Synthase 3, Endothelial NOS, eNOS, ECNOS, EC-NOS, Constitutive NOS, cNOS, Nitric Oxide Synthase Endothelial) (HRP)

Ask
View Details
NOS III, Phosphorylated (Nitric Oxide Synthase 3, Nitric Oxide Synthase 3 Endothelial Cell, NOS Type III, NOS3, Endothelial Nitric Oxide Synthase 3, Endothelial NOS, eNOS, ECNOS, EC-NOS, Constitutive NOS, cNOS, Nitric Oxide Synthase Endothelial) (HRP)
MBS6474018-02 5x 0.1 mL

NOS III, Phosphorylated (Nitric Oxide Synthase 3, Nitric Oxide Synthase 3 Endothelial Cell, NOS Type III, NOS3, Endothelial Nitric Oxide Synthase 3, Endothelial NOS, eNOS, ECNOS, EC-NOS, Constitutive NOS, cNOS, Nitric Oxide Synthase Endothelial) (HRP)

Ask
View Details