Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin D, Mouse (HEK293, His)

Cathepsin D Protein, Mouse (HEK293, His) is an approximately 56.0 kDa mouse cathepsin D with a His tag. Cathepsin D is a lysosomal aspartic protease of the pepsin family[1].

Product Specifications

Product Name Alternative

Cathepsin D Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-d-protein-mouse-hek293-his.html

Purity

99.00

Smiles

IIRIPLRKFTSIRRTMTEVGGSVEDLILKGPITKYSMQSSPKTTEPVSELLKNYLDAQYYGDIGIGTPPQCFTVVFDTGSSNLWVPSIHCKILDIACWVHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSDQSKARGIKVEKQIFGEATKQPGIVFVAAKFDGILGMGYPHISVNNVLPVFDNLMQQKLVDKNIFSFYLNRDPEGQPGGELMLGGTDSKYYHGELSYLNVTRKAYWQVHMDQLEVGNELTLCKGGCEAIVDTGTSLLVGPVEEVKELQKAIGAVPLIQGEYMIPCEKVSSLPTVYLKLGGKNYELHPDKYILKVSQGGKTICLSGFMGMDIPPPSGPLWILGDVFIGSYYTVFDRDNNRVGFANAVVLHHHHHH

Molecular Formula

13033 (Gene_ID) P18242 (I21-L410) (Accession)

Molecular Weight

Approximately 46 kDa

References & Citations

[1]H Rochefort, et al.Cathepsin D in breast cancer: mechanisms and clinical applications, a 1999 overview. Clin Chim Acta. 2000 Feb 15;291 (2) :157-70.|[2]T Tsukuba, et al. New functional aspects of cathepsin D and cathepsin E. Mol Cells

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

L-Plastin siRNA (h)
sc-43208 10 µM

L-Plastin siRNA (h)

Ask
View Details
KRT18, CT (Keratin, Type I Cytoskeletal 18, Cytokeratin-18, CK-18, Keratin-18, K18, Cell Proliferation-inducing Gene 46 Protein, PIG46, CYK18) (MaxLight 750)
MBS6484248-01 0.1 mL

KRT18, CT (Keratin, Type I Cytoskeletal 18, Cytokeratin-18, CK-18, Keratin-18, K18, Cell Proliferation-inducing Gene 46 Protein, PIG46, CYK18) (MaxLight 750)

Ask
View Details
KRT18, CT (Keratin, Type I Cytoskeletal 18, Cytokeratin-18, CK-18, Keratin-18, K18, Cell Proliferation-inducing Gene 46 Protein, PIG46, CYK18) (MaxLight 750)
MBS6484248-02 5x 0.1 mL

KRT18, CT (Keratin, Type I Cytoskeletal 18, Cytokeratin-18, CK-18, Keratin-18, K18, Cell Proliferation-inducing Gene 46 Protein, PIG46, CYK18) (MaxLight 750)

Ask
View Details
N-Arachidonoyl-3-hydroxy-gamma-aminobutyric acid
MBS3848110-01 1 mg

N-Arachidonoyl-3-hydroxy-gamma-aminobutyric acid

Ask
View Details
N-Arachidonoyl-3-hydroxy-gamma-aminobutyric acid
MBS3848110-02 5x 1 mg

N-Arachidonoyl-3-hydroxy-gamma-aminobutyric acid

Ask
View Details
Mouse CX3CL1 (Chemokine C-X3-C-Motif Ligand 1) ELISA Kit
E-EL-M0267-01 24 Tests

Mouse CX3CL1 (Chemokine C-X3-C-Motif Ligand 1) ELISA Kit

Ask
View Details