Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF basic/bFGF, Bovine (P. pastoris, N-His)

FGF2 protein is a multifunctional ligand that can bind to FGFR1, FGFR2, FGFR3 and FGFR4. It is also a key integrin ligand for FGF2 signal transduction and has an important interaction with the integrin ITGAV:ITGB3. FGF2 plays a critical role in cell survival, division, differentiation, and migration, serves as a potent mitogen, and induces angiogenesis. FGF basic/bFGF protein, Bovine (P. pastoris, N-His) is the recombinant bovine-derived FGF2 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FGF basic/bFGF protein, Bovine (P. pastoris, N-His), Bovine, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf2-protein-bovine-p-pastoris-n-his.html

Purity

97.00

Smiles

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS

Molecular Formula

281161 (Gene_ID) P03969 (P10-S155) (Accession)

Molecular Weight

18.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PI 3 Kinase p100 Antibody
KC-20241-01 50 μL

PI 3 Kinase p100 Antibody

Ask
View Details
PI 3 Kinase p100 Antibody
KC-20241-02 100 µL

PI 3 Kinase p100 Antibody

Ask
View Details
PI 3 Kinase p100 Antibody
KC-20241-03 1 mL

PI 3 Kinase p100 Antibody

Ask
View Details
FITC-Linked Polyclonal Antibody to Extracellular Matrix Metalloproteinase Inducer (EMMPRIN)
MBS2056339-01 0.1 mL

FITC-Linked Polyclonal Antibody to Extracellular Matrix Metalloproteinase Inducer (EMMPRIN)

Ask
View Details
FITC-Linked Polyclonal Antibody to Extracellular Matrix Metalloproteinase Inducer (EMMPRIN)
MBS2056339-02 0.2 mL

FITC-Linked Polyclonal Antibody to Extracellular Matrix Metalloproteinase Inducer (EMMPRIN)

Ask
View Details
FITC-Linked Polyclonal Antibody to Extracellular Matrix Metalloproteinase Inducer (EMMPRIN)
MBS2056339-03 0.5 mL

FITC-Linked Polyclonal Antibody to Extracellular Matrix Metalloproteinase Inducer (EMMPRIN)

Ask
View Details