MDK/Midkine, Human (His-Avi)
Midkine (MDK) protein is a multifunctional cytokine and growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors. MDK regulates inflammatory responses, cell proliferation, adhesion, growth, survival, tissue regeneration, differentiation, and migration and plays a crucial role in inflammation by recruiting neutrophils and macrophages. MDK/Midkine Protein, Human (His-Avi) is the recombinant human-derived MDK/Midkine protein, expressed by E. coli , with C-Avi, N-His labeled tag.
Product Specifications
Product Name Alternative
MDK/Midkine Protein, Human (His-Avi), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mdk-midkine-protein-human-his-avi.html
Purity
97.0
Smiles
VAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD
Molecular Formula
4192 (Gene_ID) P21741-1 (V21-D143) (Accession)
Molecular Weight
Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
RAF1, phosphorylated (Ser338) (RAF Proto-oncogene Serine/Threonine-protein Kinase, Proto-oncogene c-RAF, Raf-1, C-RAF, cRaf, RAF) (MaxLight 650) discontinued
RNF135, CT (RNF135, E3 ubiquitin-protein ligase RNF135, RIG-I E3 ubiquitin ligase, RING finger protein 135, Riplet) (MaxLight 490) discontinued
Recombinant Mycobacterium Vanbaalenii ureF Protein (aa 1-214)