Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MDK/Midkine, Human (His-Avi)

Midkine (MDK) protein is a multifunctional cytokine and growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors. MDK regulates inflammatory responses, cell proliferation, adhesion, growth, survival, tissue regeneration, differentiation, and migration and plays a crucial role in inflammation by recruiting neutrophils and macrophages. MDK/Midkine Protein, Human (His-Avi) is the recombinant human-derived MDK/Midkine protein, expressed by E. coli , with C-Avi, N-His labeled tag.

Product Specifications

Product Name Alternative

MDK/Midkine Protein, Human (His-Avi), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mdk-midkine-protein-human-his-avi.html

Purity

97.0

Smiles

VAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD

Molecular Formula

4192 (Gene_ID) P21741-1 (V21-D143) (Accession)

Molecular Weight

Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HNMT Rabbit Polyclonal Antibody
TA332537 100 µL

HNMT Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Von Willebrand Factor Cleaving Protease (vWFCP) ELISA Kit
EKN49302 96 Tests

Human Von Willebrand Factor Cleaving Protease (vWFCP) ELISA Kit

Sign In for Pricing
View Details
Chondroitin sulfate sodium salt
C9161-01 5 g

Chondroitin sulfate sodium salt

Sign In for Pricing
View Details
Chondroitin sulfate sodium salt
C9161-02 25 g

Chondroitin sulfate sodium salt

Sign In for Pricing
View Details
Rabbit anti-GCSAM Antibody, Affinity Purified
MBS3905661-01 0.01 mg

Rabbit anti-GCSAM Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-GCSAM Antibody, Affinity Purified
MBS3905661-02 0.1 mg

Rabbit anti-GCSAM Antibody, Affinity Purified

Sign In for Pricing
View Details