Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MDK/Midkine, Human (His-Avi)

Midkine (MDK) protein is a multifunctional cytokine and growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors. MDK regulates inflammatory responses, cell proliferation, adhesion, growth, survival, tissue regeneration, differentiation, and migration and plays a crucial role in inflammation by recruiting neutrophils and macrophages. MDK/Midkine Protein, Human (His-Avi) is the recombinant human-derived MDK/Midkine protein, expressed by E. coli , with C-Avi, N-His labeled tag.

Product Specifications

Product Name Alternative

MDK/Midkine Protein, Human (His-Avi), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mdk-midkine-protein-human-his-avi.html

Purity

97.0

Smiles

VAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD

Molecular Formula

4192 (Gene_ID) P21741-1 (V21-D143) (Accession)

Molecular Weight

Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

N1-Acetylspermine trihydrochloride
M34838-01 1 g

N1-Acetylspermine trihydrochloride

Sign In for Pricing
View Details
N1-Acetylspermine trihydrochloride
M34838-02 500 mg

N1-Acetylspermine trihydrochloride

Sign In for Pricing
View Details
N1-Acetylspermine trihydrochloride
M34838-03 5 mg

N1-Acetylspermine trihydrochloride

Sign In for Pricing
View Details
N1-Acetylspermine trihydrochloride
M34838-04 10 mg

N1-Acetylspermine trihydrochloride

Sign In for Pricing
View Details
N1-Acetylspermine trihydrochloride
M34838-05 25 mg

N1-Acetylspermine trihydrochloride

Sign In for Pricing
View Details
N1-Acetylspermine trihydrochloride
M34838-06 50 mg

N1-Acetylspermine trihydrochloride

Sign In for Pricing
View Details