Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MDK/Midkine, Human (His-Avi)

Midkine (MDK) protein is a multifunctional cytokine and growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors. MDK regulates inflammatory responses, cell proliferation, adhesion, growth, survival, tissue regeneration, differentiation, and migration and plays a crucial role in inflammation by recruiting neutrophils and macrophages. MDK/Midkine Protein, Human (His-Avi) is the recombinant human-derived MDK/Midkine protein, expressed by E. coli , with C-Avi, N-His labeled tag.

Product Specifications

Product Name Alternative

MDK/Midkine Protein, Human (His-Avi), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mdk-midkine-protein-human-his-avi.html

Purity

97.0

Smiles

VAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD

Molecular Formula

4192 (Gene_ID) P21741-1 (V21-D143) (Accession)

Molecular Weight

Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCMV-3xFLAG-ENO1 (human) -Neo
BZ59491 1 Vial

PCMV-3xFLAG-ENO1 (human) -Neo

Sign In for Pricing
View Details
4-Isopropoxyaniline
432889-01 100 mg

4-Isopropoxyaniline

Sign In for Pricing
View Details
4-Isopropoxyaniline
432889-02 250 mg

4-Isopropoxyaniline

Sign In for Pricing
View Details
Anti-MAP3K4 Antibody (R2R67)
RHN78701 100 μg

Anti-MAP3K4 Antibody (R2R67)

Sign In for Pricing
View Details
RBAKDN Human qPCR Primer Pair (NM_203393)
HP219548 200 Reactions

RBAKDN Human qPCR Primer Pair (NM_203393)

Sign In for Pricing
View Details
Lentiviral human GJB4 shRNA (UAS) - Lentiviral human GJB4 shRNA (UAS, GFP) (100)
GTR15107709 1 Vial

Lentiviral human GJB4 shRNA (UAS) - Lentiviral human GJB4 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details