MDK/Midkine, Human (His-Avi)
Midkine (MDK) protein is a multifunctional cytokine and growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors. MDK regulates inflammatory responses, cell proliferation, adhesion, growth, survival, tissue regeneration, differentiation, and migration and plays a crucial role in inflammation by recruiting neutrophils and macrophages. MDK/Midkine Protein, Human (His-Avi) is the recombinant human-derived MDK/Midkine protein, expressed by E. coli , with C-Avi, N-His labeled tag.
Product Specifications
Product Name Alternative
MDK/Midkine Protein, Human (His-Avi), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mdk-midkine-protein-human-his-avi.html
Purity
97.0
Smiles
VAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD
Molecular Formula
4192 (Gene_ID) P21741-1 (V21-D143) (Accession)
Molecular Weight
Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Tmem184a (NM_001025413) Rat Tagged Lenti ORF Clone
BTLA (B- and T-lymphocyte Associated Protein, B- and T-lymphocyte Attenuator, BTLA1, CD272, CD272 Antigen, FLJ16065, MGC129743) discontinued
HIST2H2AA (Histone H2A Type 2-A, Histone H2A.2, Histone H2A/o, HIST2H2AA3, H2AFO, HIST2H2AA4)
SPINT1 Mouse Monoclonal Antibody [Clone ID: OTI4E3]