Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MDK/Midkine, Human (His-Avi)

Midkine (MDK) protein is a multifunctional cytokine and growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors. MDK regulates inflammatory responses, cell proliferation, adhesion, growth, survival, tissue regeneration, differentiation, and migration and plays a crucial role in inflammation by recruiting neutrophils and macrophages. MDK/Midkine Protein, Human (His-Avi) is the recombinant human-derived MDK/Midkine protein, expressed by E. coli , with C-Avi, N-His labeled tag.

Product Specifications

Product Name Alternative

MDK/Midkine Protein, Human (His-Avi), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mdk-midkine-protein-human-his-avi.html

Purity

97.0

Smiles

VAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD

Molecular Formula

4192 (Gene_ID) P21741-1 (V21-D143) (Accession)

Molecular Weight

Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PCGF1 Polyclonal Antibody
MF-0082495-01 50 µL

Anti-PCGF1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-PCGF1 Polyclonal Antibody
MF-0082495-02 100 µL

Anti-PCGF1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-PCGF1 Polyclonal Antibody
MF-0082495-03 200 µL

Anti-PCGF1 Polyclonal Antibody

Sign In for Pricing
View Details
1/2 inch wide x 500 inch Silver Labeling Tape
TAP1196 1 Each

1/2 inch wide x 500 inch Silver Labeling Tape

Sign In for Pricing
View Details
A530099J19Rik sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3341804 1.0 µg DNA

A530099J19Rik sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
anti-NUDT2
YF-PA10240 50 ul

anti-NUDT2

Sign In for Pricing
View Details