Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MDK/Midkine, Human (His-Avi)

Midkine (MDK) protein is a multifunctional cytokine and growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors. MDK regulates inflammatory responses, cell proliferation, adhesion, growth, survival, tissue regeneration, differentiation, and migration and plays a crucial role in inflammation by recruiting neutrophils and macrophages. MDK/Midkine Protein, Human (His-Avi) is the recombinant human-derived MDK/Midkine protein, expressed by E. coli , with C-Avi, N-His labeled tag.

Product Specifications

Product Name Alternative

MDK/Midkine Protein, Human (His-Avi), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mdk-midkine-protein-human-his-avi.html

Purity

97.0

Smiles

VAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD

Molecular Formula

4192 (Gene_ID) P21741-1 (V21-D143) (Accession)

Molecular Weight

Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) MNN4 Polyclonal Antibody
MBS7156463 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) MNN4 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-GYG1 antibody
SL3990R-01 50 µL

Rabbit Anti-GYG1 antibody

Sign In for Pricing
View Details
Rabbit Anti-GYG1 antibody
SL3990R-02 100 µL

Rabbit Anti-GYG1 antibody

Sign In for Pricing
View Details
Fam134c 3'UTR GFP Stable Cell Line
TU156150 1.0 mL

Fam134c 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Human GZMH, N-His
MBS1573590-01 0.1 mg

Recombinant Human GZMH, N-His

Sign In for Pricing
View Details
Recombinant Human GZMH, N-His
MBS1573590-02 1 mg

Recombinant Human GZMH, N-His

Sign In for Pricing
View Details