MDK/Midkine, Human (His-Avi)
Midkine (MDK) protein is a multifunctional cytokine and growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors. MDK regulates inflammatory responses, cell proliferation, adhesion, growth, survival, tissue regeneration, differentiation, and migration and plays a crucial role in inflammation by recruiting neutrophils and macrophages. MDK/Midkine Protein, Human (His-Avi) is the recombinant human-derived MDK/Midkine protein, expressed by E. coli , with C-Avi, N-His labeled tag.
Product Specifications
Product Name Alternative
MDK/Midkine Protein, Human (His-Avi), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mdk-midkine-protein-human-his-avi.html
Purity
97.0
Smiles
VAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD
Molecular Formula
4192 (Gene_ID) P21741-1 (V21-D143) (Accession)
Molecular Weight
Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
GENLISA™ Bovine Lectin Like Oxidized Low Density Lipoprotein Receptor 1 (LOX1) ELISA
OPLAH sgRNA CRISPR Lentivector (Human) (Target 2)
TSC1, phosphorylated (Y304) (TSC1, KIAA0243, TSC, Hamartin, Tuberous sclerosis 1 protein) (FITC) discontinued
