Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MDK/Midkine, Human (His-Avi)

Midkine (MDK) protein is a multifunctional cytokine and growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors. MDK regulates inflammatory responses, cell proliferation, adhesion, growth, survival, tissue regeneration, differentiation, and migration and plays a crucial role in inflammation by recruiting neutrophils and macrophages. MDK/Midkine Protein, Human (His-Avi) is the recombinant human-derived MDK/Midkine protein, expressed by E. coli , with C-Avi, N-His labeled tag.

Product Specifications

Product Name Alternative

MDK/Midkine Protein, Human (His-Avi), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mdk-midkine-protein-human-his-avi.html

Purity

97.0

Smiles

VAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD

Molecular Formula

4192 (Gene_ID) P21741-1 (V21-D143) (Accession)

Molecular Weight

Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

POLR2A Monoclonal Antibody
BT-MCA4834-01 50 µL

POLR2A Monoclonal Antibody

Sign In for Pricing
View Details
POLR2A Monoclonal Antibody
BT-MCA4834-02 100 µL

POLR2A Monoclonal Antibody

Sign In for Pricing
View Details
Human SNURF (NM_022804) AAV Particle
RC220542A1V 250 µL

Human SNURF (NM_022804) AAV Particle

Sign In for Pricing
View Details
Hepatitis B Core Antigen, adw, ayw (HBcAg) (Biotin)
H1905-09F-Biotin 100 µL

Hepatitis B Core Antigen, adw, ayw (HBcAg) (Biotin)

Sign In for Pricing
View Details
TRNAL11 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV752662 1.0 µg DNA

TRNAL11 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
ADSS Rabbit pAb
E45R19028N-100 100 µL

ADSS Rabbit pAb

Sign In for Pricing
View Details