Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MDK/Midkine, Human (His-Avi)

Midkine (MDK) protein is a multifunctional cytokine and growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors. MDK regulates inflammatory responses, cell proliferation, adhesion, growth, survival, tissue regeneration, differentiation, and migration and plays a crucial role in inflammation by recruiting neutrophils and macrophages. MDK/Midkine Protein, Human (His-Avi) is the recombinant human-derived MDK/Midkine protein, expressed by E. coli , with C-Avi, N-His labeled tag.

Product Specifications

Product Name Alternative

MDK/Midkine Protein, Human (His-Avi), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mdk-midkine-protein-human-his-avi.html

Purity

97.0

Smiles

VAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD

Molecular Formula

4192 (Gene_ID) P21741-1 (V21-D143) (Accession)

Molecular Weight

Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM234B protein, Human, Recombinant (His)
E51P80234 20 µg

FAM234B protein, Human, Recombinant (His)

Sign In for Pricing
View Details
POLG Rabbit Monoclonal antibody
AMRe03155-01 1 Each

POLG Rabbit Monoclonal antibody

Sign In for Pricing
View Details
POLG Rabbit Monoclonal antibody
AMRe03155-02 50 µL

POLG Rabbit Monoclonal antibody

Sign In for Pricing
View Details
POLG Rabbit Monoclonal antibody
AMRe03155-03 100 µL

POLG Rabbit Monoclonal antibody

Sign In for Pricing
View Details
UBE2D4 (NM_015983) Human Tagged ORF Clone
RG202473 10 µg

UBE2D4 (NM_015983) Human Tagged ORF Clone

Sign In for Pricing
View Details
H2-M10.4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3006007 1.0 µg DNA

H2-M10.4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details