Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MDK/Midkine, Human (His-Avi)

Midkine (MDK) protein is a multifunctional cytokine and growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors. MDK regulates inflammatory responses, cell proliferation, adhesion, growth, survival, tissue regeneration, differentiation, and migration and plays a crucial role in inflammation by recruiting neutrophils and macrophages. MDK/Midkine Protein, Human (His-Avi) is the recombinant human-derived MDK/Midkine protein, expressed by E. coli , with C-Avi, N-His labeled tag.

Product Specifications

Product Name Alternative

MDK/Midkine Protein, Human (His-Avi), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mdk-midkine-protein-human-his-avi.html

Purity

97.0

Smiles

VAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD

Molecular Formula

4192 (Gene_ID) P21741-1 (V21-D143) (Accession)

Molecular Weight

Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein 5NUC Antibody
MBS7160109 Inquire

Protein 5NUC Antibody

Sign In for Pricing
View Details
Human Interleukin 1
MBS430223-01 0.01 mg

Human Interleukin 1

Sign In for Pricing
View Details
Human Interleukin 1
MBS430223-02 5x 0.01 mg

Human Interleukin 1

Sign In for Pricing
View Details
multiSUB Maxi Comb, 16 sample, 1.5mm thick
MS20-16-1.5 1 Unit

multiSUB Maxi Comb, 16 sample, 1.5mm thick

Sign In for Pricing
View Details
pCMV-SPORT6-BOLA-DQA2 Plasmid
PVT34286 2 µg

pCMV-SPORT6-BOLA-DQA2 Plasmid

Sign In for Pricing
View Details
Mouse Monoclonal Astrovirus type 2 Antibody (8-E7) [Alexa Fluor 647]
NB100-63066AF647 0.5 mL

Mouse Monoclonal Astrovirus type 2 Antibody (8-E7) [Alexa Fluor 647]

Sign In for Pricing
View Details