Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MDK/Midkine, Human (His-Avi)

Midkine (MDK) protein is a multifunctional cytokine and growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors. MDK regulates inflammatory responses, cell proliferation, adhesion, growth, survival, tissue regeneration, differentiation, and migration and plays a crucial role in inflammation by recruiting neutrophils and macrophages. MDK/Midkine Protein, Human (His-Avi) is the recombinant human-derived MDK/Midkine protein, expressed by E. coli , with C-Avi, N-His labeled tag.

Product Specifications

Product Name Alternative

MDK/Midkine Protein, Human (His-Avi), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mdk-midkine-protein-human-his-avi.html

Purity

97.0

Smiles

VAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD

Molecular Formula

4192 (Gene_ID) P21741-1 (V21-D143) (Accession)

Molecular Weight

Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPT20 Antibody
MBS9520872-01 0.04 mL

SPT20 Antibody

Sign In for Pricing
View Details
SPT20 Antibody
MBS9520872-02 0.1 mL

SPT20 Antibody

Sign In for Pricing
View Details
SPT20 Antibody
MBS9520872-03 0.2 mL

SPT20 Antibody

Sign In for Pricing
View Details
SPT20 Antibody
MBS9520872-04 5x 0.2 mL

SPT20 Antibody

Sign In for Pricing
View Details
MLH1 Mouse Monoclonal Antibody [Clone ID: OTI3D1]
TA810268S 30 µL

MLH1 Mouse Monoclonal Antibody [Clone ID: OTI3D1]

Sign In for Pricing
View Details
Bag1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-62568R-BF555-01 20 µL

Bag1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details