Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MDK/Midkine, Human (His-Avi)

Midkine (MDK) protein is a multifunctional cytokine and growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors. MDK regulates inflammatory responses, cell proliferation, adhesion, growth, survival, tissue regeneration, differentiation, and migration and plays a crucial role in inflammation by recruiting neutrophils and macrophages. MDK/Midkine Protein, Human (His-Avi) is the recombinant human-derived MDK/Midkine protein, expressed by E. coli , with C-Avi, N-His labeled tag.

Product Specifications

Product Name Alternative

MDK/Midkine Protein, Human (His-Avi), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mdk-midkine-protein-human-his-avi.html

Purity

97.0

Smiles

VAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD

Molecular Formula

4192 (Gene_ID) P21741-1 (V21-D143) (Accession)

Molecular Weight

Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF185 (NM_001135824) Human Tagged ORF Clone Lentiviral Particle
RC226752L3V 200 µL

RNF185 (NM_001135824) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
NFE2L3 (NM_004289) Human Untagged Clone
SC322097 10 µg

NFE2L3 (NM_004289) Human Untagged Clone

Sign In for Pricing
View Details
SARS-CoV-2 (2019-nCoV) Spike RBD(A522S)-His Recombinant HEK293 Cell Lysate (WB positive control)
MBS8119678-01 0.3 mg

SARS-CoV-2 (2019-nCoV) Spike RBD(A522S)-His Recombinant HEK293 Cell Lysate (WB positive control)

Sign In for Pricing
View Details
SARS-CoV-2 (2019-nCoV) Spike RBD(A522S)-His Recombinant HEK293 Cell Lysate (WB positive control)
MBS8119678-02 5x 0.3 mg

SARS-CoV-2 (2019-nCoV) Spike RBD(A522S)-His Recombinant HEK293 Cell Lysate (WB positive control)

Sign In for Pricing
View Details
5-Nitro-1H-imidazole-1-ethanol
TRC-N496230-50MG 50 mg

5-Nitro-1H-imidazole-1-ethanol

Sign In for Pricing
View Details
Purified Anti-Human IL-10 Antibody[JES3-9D7]
E-AB-F1198A-01 25 µg

Purified Anti-Human IL-10 Antibody[JES3-9D7]

Sign In for Pricing
View Details