Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MDK/Midkine, Human (His-Avi)

Midkine (MDK) protein is a multifunctional cytokine and growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors. MDK regulates inflammatory responses, cell proliferation, adhesion, growth, survival, tissue regeneration, differentiation, and migration and plays a crucial role in inflammation by recruiting neutrophils and macrophages. MDK/Midkine Protein, Human (His-Avi) is the recombinant human-derived MDK/Midkine protein, expressed by E. coli , with C-Avi, N-His labeled tag.

Product Specifications

Product Name Alternative

MDK/Midkine Protein, Human (His-Avi), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mdk-midkine-protein-human-his-avi.html

Purity

97.0

Smiles

VAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD

Molecular Formula

4192 (Gene_ID) P21741-1 (V21-D143) (Accession)

Molecular Weight

Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ucn2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7053308 1.0 µg DNA

Ucn2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Vmn1r118 (NM_001166742) Mouse Tagged ORF Clone
MR224523 10 µg

Vmn1r118 (NM_001166742) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Anti-Mouse CD152/CTLA4 Antibody (9D9)
FMD17220 100 μg

Anti-Mouse CD152/CTLA4 Antibody (9D9)

Sign In for Pricing
View Details
MARCH2 (MARCHF2) (NM_016496) Human Tagged ORF Clone Lentiviral Particle
RC207517L2V 200 µL

MARCH2 (MARCHF2) (NM_016496) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Lentiviral human PTPRU shRNA (UAS) - Lentiviral human PTPRU shRNA (UAS, GFP) plasmid
GTR15343993 1 Vial

Lentiviral human PTPRU shRNA (UAS) - Lentiviral human PTPRU shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Rat Foxk2 Pre-designed siRNA Set B
SI205202B 1 Each

Rat Foxk2 Pre-designed siRNA Set B

Sign In for Pricing
View Details