Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM173, Human (Sumo-His)

The TMEM173 protein acts as a promoter of innate immune signaling, acting as a sensor of bacterial and viral cytoplasmic DNA, ultimately promoting the production of type I interferons (IFN-α and IFN-β) . This innate immune response is triggered in response to the delivery of non-CpG double-stranded DNA from viruses and bacteria into the cytoplasm. TMEM173 Protein, Human (Sumo-His) is the recombinant human-derived TMEM173 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

TMEM173 Protein, Human (Sumo-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmem173-protein-human-hek-293-sumo-his.html

Purity

98.44

Smiles

VAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEV

Molecular Formula

340061 (Gene_ID) Q86WV6 (V155-V341) (Accession)

Molecular Weight

35-38 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Buccutite™ ALP (Alkaline Phosphatase) Antibody Conjugation Kit *Optimized for Labeling 25 ug Protein*
5512-AAT 2 Labelings

Buccutite™ ALP (Alkaline Phosphatase) Antibody Conjugation Kit *Optimized for Labeling 25 ug Protein*

Sign In for Pricing
View Details
Cbl c (CBLC) (NM_001130852) Human Over-expression Lysate
LY427289 100 µg

Cbl c (CBLC) (NM_001130852) Human Over-expression Lysate

Sign In for Pricing
View Details
FGFR3 (NM_000142) Human Over-expression Lysate
LC424902 20 µg

FGFR3 (NM_000142) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS504678 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Pus7 Mouse Gene Knockout Kit (CRISPR)
KN514262 1 Kit

Pus7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human IL-2 Receptor alpha Recombinant Rabbit Monoclonal Antibody [PS01-03] - BSA and Azide free (Detector)
HA721281 100 µL

Human IL-2 Receptor alpha Recombinant Rabbit Monoclonal Antibody [PS01-03] - BSA and Azide free (Detector)

Sign In for Pricing
View Details