Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM173, Human (Sumo-His)

The TMEM173 protein acts as a promoter of innate immune signaling, acting as a sensor of bacterial and viral cytoplasmic DNA, ultimately promoting the production of type I interferons (IFN-α and IFN-β) . This innate immune response is triggered in response to the delivery of non-CpG double-stranded DNA from viruses and bacteria into the cytoplasm. TMEM173 Protein, Human (Sumo-His) is the recombinant human-derived TMEM173 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

TMEM173 Protein, Human (Sumo-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmem173-protein-human-hek-293-sumo-his.html

Purity

98.44

Smiles

VAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEV

Molecular Formula

340061 (Gene_ID) Q86WV6 (V155-V341) (Accession)

Molecular Weight

35-38 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTDSS2 (N-term) Rabbit Polyclonal Antibody
AP53496PU-N 400 µL

PTDSS2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(S)-Nornicotine
TRC-N756995-250MG 250 mg

(S)-Nornicotine

Sign In for Pricing
View Details
C6orf114 (NM_033069) Human Over-expression Lysate
LY403223 100 µg

C6orf114 (NM_033069) Human Over-expression Lysate

Sign In for Pricing
View Details
Cathepsin K (Marker of Tumor Invasiveness) (CTSK/2793), CF647 conjugate, 0.1mg/mL
BNC472793-500 1x 500 µL

Cathepsin K (Marker of Tumor Invasiveness) (CTSK/2793), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Blocks, Prostate
CB527516 1 Block

Frozen Tissue Blocks, Prostate

Sign In for Pricing
View Details
2,2’-(1,4-Piperazinediyl)bis-pyrimidine
TRC-P991770-5G 5 g

2,2’-(1,4-Piperazinediyl)bis-pyrimidine

Sign In for Pricing
View Details