Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM173, Human (Sumo-His)

The TMEM173 protein acts as a promoter of innate immune signaling, acting as a sensor of bacterial and viral cytoplasmic DNA, ultimately promoting the production of type I interferons (IFN-α and IFN-β) . This innate immune response is triggered in response to the delivery of non-CpG double-stranded DNA from viruses and bacteria into the cytoplasm. TMEM173 Protein, Human (Sumo-His) is the recombinant human-derived TMEM173 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

TMEM173 Protein, Human (Sumo-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmem173-protein-human-hek-293-sumo-his.html

Purity

98.44

Smiles

VAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEV

Molecular Formula

340061 (Gene_ID) Q86WV6 (V155-V341) (Accession)

Molecular Weight

35-38 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPAST Antibody
orb524185-01 50 μL

SPAST Antibody

Sign In for Pricing
View Details
SPAST Antibody
orb524185-02 100 µL

SPAST Antibody

Sign In for Pricing
View Details
CSNK1D siRNA Oligos set (Human)
16943171 3x 5 nmol

CSNK1D siRNA Oligos set (Human)

Sign In for Pricing
View Details
SBSN Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
43058066 1.0 µg DNA

SBSN Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
GCLC (Glutamate-cysteine Ligase Catalytic Subunit, GCL, GLCL, GLCLC, Gamma-glutamylcysteine Synthetase, Gamma-ECS, GCS Heavy Chain) (HRP)
MBS6152652-01 0.1 mL

GCLC (Glutamate-cysteine Ligase Catalytic Subunit, GCL, GLCL, GLCLC, Gamma-glutamylcysteine Synthetase, Gamma-ECS, GCS Heavy Chain) (HRP)

Sign In for Pricing
View Details
GCLC (Glutamate-cysteine Ligase Catalytic Subunit, GCL, GLCL, GLCLC, Gamma-glutamylcysteine Synthetase, Gamma-ECS, GCS Heavy Chain) (HRP)
MBS6152652-02 5x 0.1 mL

GCLC (Glutamate-cysteine Ligase Catalytic Subunit, GCL, GLCL, GLCLC, Gamma-glutamylcysteine Synthetase, Gamma-ECS, GCS Heavy Chain) (HRP)

Sign In for Pricing
View Details