Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OCIL/CLEC2D, Human (HEK293, Fc-Avi)

The OCIL/CLEC2D protein acts as a receptor for KLRB1 and protects target cells from natural killer cell-mediated lysis. It not only inhibits osteoclast formation and bone resorption, but also regulates the release of interferon-γ, indicating that it has immune and bone-related regulatory functions. OCIL/CLEC2D Protein, Human (HEK293, Fc-Avi) is the recombinant human-derived OCIL/CLEC2D protein, expressed by HEK293 , with N-hFc, N-Avi labeled tag.

Product Specifications

Product Name Alternative

OCIL/CLEC2D Protein, Human (HEK293, Fc-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ocil-clec2d-protein-human-hek293-fc-avi.html

Purity

95.0

Smiles

RANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQFPILGAGECAYLNDKGASSARHYTERKWICSKSDIHV

Molecular Formula

29121 (Gene_ID) Q9UHP7-1 (R60-V191) (Accession)

Molecular Weight

68-78 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LNX2 Antibody
KC-30181-01 50 μL

LNX2 Antibody

Sign In for Pricing
View Details
LNX2 Antibody
KC-30181-02 100 µL

LNX2 Antibody

Sign In for Pricing
View Details
LNX2 Antibody
KC-30181-03 1 mL

LNX2 Antibody

Sign In for Pricing
View Details
Climbazole-D4
TRC-C578502-1MG 1 mg

Climbazole-D4

Sign In for Pricing
View Details
eIF3s8 (EIF3C) (NM_001037808) Human Over-expression Lysate
LC421989 20 µg

eIF3s8 (EIF3C) (NM_001037808) Human Over-expression Lysate

Sign In for Pricing
View Details
Spata31d1d Mouse Gene Knockout Kit (CRISPR)
KN516557 1 Kit

Spata31d1d Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details