Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3D, Mouse (HEK293, Fc)

The CD3D protein is an important component of the TCR-CD3 complex on T lymphocytes and is critical for adaptive immune responses. After APC activates TCR, CD3D, together with CD3E, CD3G and CD3Z, transmits signals through ITAM and activates downstream pathways. CD3D Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD3D protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD3D Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd3d-protein-mouse-hek293-fc.html

Purity

98.00

Smiles

FKIQVTEYEDKVFVTCNTSVMHLDGTVEGWFAKNKTLNLGKGVLDPRGIYLCNGTEQLAKVVSSVQVHYRMCQNCVELDSGTMA

Molecular Formula

12500 (Gene_ID) P04235 (F22-A105) (Accession)

Molecular Weight

Approximately 48-65 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human NOSIP Protein - (Dry Ice)
H00051070-P01-10ug 10 µg

Recombinant Human NOSIP Protein - (Dry Ice)

Sign In for Pricing
View Details
CD256 Antibody
MBS8581222-01 0.1 mL

CD256 Antibody

Sign In for Pricing
View Details
CD256 Antibody
MBS8581222-02 0.1 mL (AF635)

CD256 Antibody

Sign In for Pricing
View Details
CD256 Antibody
MBS8581222-03 0.1 mL (AF610)

CD256 Antibody

Sign In for Pricing
View Details
CD256 Antibody
MBS8581222-04 0.1 mL (AF405S)

CD256 Antibody

Sign In for Pricing
View Details
CD256 Antibody
MBS8581222-05 0.1 mL (AF405L)

CD256 Antibody

Sign In for Pricing
View Details