Recombinant Avian infectious bronchitis virus Spike glycoprotein (S), partial
Product Specifications
Product Name Alternative
(S glycoprotein) (E2) (Peplomer protein)
Abbreviation
Recombinant Avian infectious bronchitis virus S protein, partial
Gene Name
S
UniProt
P12650
Expression Region
317-537aa
Organism
Avian infectious bronchitis virus (strain KB8523) (IBV)
Target Sequence
ESNFMYGSYHPSCSFRLETINNGLWFNSLSVSIAYGPLQGGCKQSVFSGRATCCYAYSYGGPLLCKGVYSGELDHNFECGLLVYVTKSGGSRIQTATEPPVITQHNYNNITLNTCVDYNIYGRIGQGFITNVTDSAVSYNYLADAGLAILDTSGSIDIFVVQSEYGLNYYKVNPCEDVNQQFVVSGGKLVGILTSRNETGSQLLENQFYIKITNGTRRFRR
Tag
C-terminal 6xHis-tagged
Type
Developed Protein
Source
In vitro E.coli expression system
Field of Research
Microbiology
Relevance
[Spike protein S1]: Attaches the virion to the host cell membrane by interacting with sialic acids, initiating the infection.; [Spike protein S2]: Mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes.; [Spike protein S2']: Acts as a viral fusion peptide after S2 cleavage occurring upon virus endocytosis.
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight
26.8 kDa
References & Citations
"Cloning and sequencing of genes encoding structural proteins of avian infectious bronchitis virus." Sutou S., Sato S., Okabe T., Nakai M., Sasaki N. Virology 165:589-595 (1988)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Partial
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items