Cystatin D/CST5, Human (HEK293, His)
Cystatin D (CST5), a cysteine proteinase inhibitor, potentially safeguards against oral cavity proteinases. Exhibiting specificity, it preferentially inhibits cathepsin S, cathepsin H, cathepsin L, and cathepsin B. This nuanced regulation emphasizes Cystatin D's role in modulating specific cysteine proteinases, signifying its importance in proteostasis and potential involvement in oral health. Cystatin D/CST5 Protein, Human (HEK293, His) is the recombinant human-derived Cystatin D/CST5 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
Cystatin D/CST5 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cystatin-d-cst5-protein-human-hek-293-his.html
Smiles
GSASAQSRTLAGGIHATDLNDKSVQCALDFAISEYNKVINKDEYYSRPLQVMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCSFQINEVPWEDKISILNYKCRKV
Molecular Formula
1473 (Gene_ID) P28325 (G21-V142) (Accession)
Molecular Weight
Approximately 15 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog