Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pro-neuregulin-1, membrane-bound isoform (NRG1) , partial

Product Specifications

CAS Number

9000-83-3

Gene Name

NRG1

UniProt

Q02297

Expression Region

176-246aa

Organism

Homo sapiens

Target Sequence

TSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAEELYQK

Tag

N-terminal 6xHis-tagged

Source

E.coli

Field of Research

Neuroscience

Assay Type

Developed Protein

Relevance

Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. The multiple isoforms perform diverse functions such as inducing growth and differentiation of epithelial, glial, neuronal, and skeletal muscle cells; inducing expression of acetylcholine receptor in synaptic vesicles during the formation of the neuromuscular junction; stimulating lobuloalveolar budding and milk production in the mammary gland and inducing differentiation of mammary tumor cells; stimulating Schwann cell proliferation; implication in the development of the myocardium such as trabeculation of the developing heart. Isoform 10 may play a role in motor and sensory neuron development. Binds to ERBB4. Binds to ERBB3. Acts as a ligand for integrins and binds via EGF domain to integrins ITGAV:ITGB3 or ITGA6:ITGB4. Its binding to integrins and subsequent ternary complex formation with integrins and ERRB3 are essential for NRG1-ERBB signaling. Induces the phosphorylation and activation of MAPK3/ERK1, MAPK1/ERK2 and AKT1. Ligand-dependent ERBB4 endocytosis is essential for the NRG1-mediated activation of these kinases in neurons.

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Length

Partial of Isoform 6

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Human CD218b/IL18RAP Protein, C-Strep
HF719011-01 50 µg

Recombinant Human CD218b/IL18RAP Protein, C-Strep

Ask
View Details
Recombinant Human CD218b/IL18RAP Protein, C-Strep
HF719011-02 100 µg

Recombinant Human CD218b/IL18RAP Protein, C-Strep

Ask
View Details
Recombinant Human CD218b/IL18RAP Protein, C-Strep
HF719011-03 1 mg

Recombinant Human CD218b/IL18RAP Protein, C-Strep

Ask
View Details
AGO3 Antibody, Biotin conjugated
A77247-50UL 50 μL

AGO3 Antibody, Biotin conjugated

Ask
View Details
ABflo® 647 Rabbit anti-Mouse CD25 mAb
A23808-01 100 Tests

ABflo® 647 Rabbit anti-Mouse CD25 mAb

Ask
View Details
ABflo® 647 Rabbit anti-Mouse CD25 mAb
A23808-02 200 Tests

ABflo® 647 Rabbit anti-Mouse CD25 mAb

Ask
View Details