Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHH, Mouse

SHH Protein, Mouse is a morphogenic factor that actively orchestrates many aspects of cerebellar development and maturation.

Product Specifications

Product Name Alternative

SHH Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/shh-protein-mouse.html

Purity

98.0

Smiles

IVIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG

Molecular Formula

20423 (Gene_ID) Q62226 (C25-G198, C25I-V-I) (Accession)

Molecular Weight

Approximately 19.8 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]De Luca A, et al. Sonic hedgehog patterning during cerebellar development. Cell Mol Life Sci. 2016 Jan; 73 (2) :291-303.|[2]Zeng Q, et al. Protective Effects of Sonic Hedgehog Against Ischemia/Reperfusion Injury in Mouse Skeletal Muscle via AKT/mTOR/p70S6K Signaling.Cell Physiol Biochem. 2017;43 (5) :1813-1828.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Syntenin (SDCBP) Human Over-expression Lysate
orb1366956 20 µg

Syntenin (SDCBP) Human Over-expression Lysate

Sign In for Pricing
View Details
Themis (A-11) : m-IgG2a BP-HRP Bundle
sc-547659 1 Kit

Themis (A-11) : m-IgG2a BP-HRP Bundle

Sign In for Pricing
View Details
ZNF117, NT (ZNF117, Zinc finger protein 117, Provirus-linked krueppel, Zinc finger protein HPF9) (APC)
MBS6365591-01 0.2 mL

ZNF117, NT (ZNF117, Zinc finger protein 117, Provirus-linked krueppel, Zinc finger protein HPF9) (APC)

Sign In for Pricing
View Details
ZNF117, NT (ZNF117, Zinc finger protein 117, Provirus-linked krueppel, Zinc finger protein HPF9) (APC)
MBS6365591-02 5x 0.2 mL

ZNF117, NT (ZNF117, Zinc finger protein 117, Provirus-linked krueppel, Zinc finger protein HPF9) (APC)

Sign In for Pricing
View Details
CUR-IPA
orb2944614-01 50 mg

CUR-IPA

Sign In for Pricing
View Details
CUR-IPA
orb2944614-02 10 mg

CUR-IPA

Sign In for Pricing
View Details