Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P38 gamma/MAPK12, Human (Active, sf9, GST)

The p38 gamma/MAPK12 protein is an important serine/threonine kinase in the MAP kinase pathway and can respond to extracellular stimuli such as pro-inflammatory cytokines or stress. p38 MAPK activates transcription factors such as ELK1 and ATF2, each of which phosphorylates approximately 200 to 300 substrates. p38 gamma/MAPK12 Protein, Human (Active, sf9, GST) is the recombinant human-derived p38 gamma/MAPK12 protein, expressed by Sf9 insect cells, with N-GST labeled tag.

Product Specifications

Product Name Alternative

P38 gamma/MAPK12 Protein, Human (Active, sf9, GST), Human, Sf9 insect cells

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/p38-gamma-mapk12-protein-human-active-sf9-gst.html

Smiles

SSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPL

Molecular Formula

6300 (Gene_ID) P53778-1 (S2-L367) (Accession)

Molecular Weight

Approximately 68.5 kDa

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atg7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6695408 1.0 µg DNA

Atg7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Mouse Perp Pre-designed siRNA Set B
SI110382B 1 Each

Mouse Perp Pre-designed siRNA Set B

Sign In for Pricing
View Details
Cyclin A (CCN1, CCNA)
144417 100 µg

Cyclin A (CCN1, CCNA)

Sign In for Pricing
View Details
ONO-AE3-208 10mg
A11516-10 10 mg

ONO-AE3-208 10mg

Sign In for Pricing
View Details
Filter PES 25mm 0.22um
SYR2320 500 / PCK

Filter PES 25mm 0.22um

Sign In for Pricing
View Details
Comb 10 sample, 2 mm thick
ME15-10-2 1 Unit

Comb 10 sample, 2 mm thick

Sign In for Pricing
View Details