Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P38 gamma/MAPK12, Human (Active, sf9, GST)

The p38 gamma/MAPK12 protein is an important serine/threonine kinase in the MAP kinase pathway and can respond to extracellular stimuli such as pro-inflammatory cytokines or stress. p38 MAPK activates transcription factors such as ELK1 and ATF2, each of which phosphorylates approximately 200 to 300 substrates. p38 gamma/MAPK12 Protein, Human (Active, sf9, GST) is the recombinant human-derived p38 gamma/MAPK12 protein, expressed by Sf9 insect cells, with N-GST labeled tag.

Product Specifications

Product Name Alternative

P38 gamma/MAPK12 Protein, Human (Active, sf9, GST), Human, Sf9 insect cells

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/p38-gamma-mapk12-protein-human-active-sf9-gst.html

Smiles

SSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPL

Molecular Formula

6300 (Gene_ID) P53778-1 (S2-L367) (Accession)

Molecular Weight

Approximately 68.5 kDa

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCPTP1 (PTPRR) (NM_001207015) Human Tagged ORF Clone
RC238835 10 µg

PCPTP1 (PTPRR) (NM_001207015) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Monoclonal HLA ABC Antibody (MHC-I/8147R) [Alexa Fluor 405]
NBP3-20852AF405 0.1 mL

Rabbit Monoclonal HLA ABC Antibody (MHC-I/8147R) [Alexa Fluor 405]

Sign In for Pricing
View Details
EREG (NM_001432) Human Untagged Clone
SC303018 10 µg

EREG (NM_001432) Human Untagged Clone

Sign In for Pricing
View Details
Serotonin Receptor 2C (HTR2C, 5-hydroxytryptamine Receptor 2C, 5-HT-2C, 5-HT2C, 5-HTR2C, 5-hydroxytryptamine Receptor 1C, 5-HT-1C, 5-HT1C, HTR1C) (HRP)
MBS6154894-01 0.1 mL

Serotonin Receptor 2C (HTR2C, 5-hydroxytryptamine Receptor 2C, 5-HT-2C, 5-HT2C, 5-HTR2C, 5-hydroxytryptamine Receptor 1C, 5-HT-1C, 5-HT1C, HTR1C) (HRP)

Sign In for Pricing
View Details
Serotonin Receptor 2C (HTR2C, 5-hydroxytryptamine Receptor 2C, 5-HT-2C, 5-HT2C, 5-HTR2C, 5-hydroxytryptamine Receptor 1C, 5-HT-1C, 5-HT1C, HTR1C) (HRP)
MBS6154894-02 5x 0.1 mL

Serotonin Receptor 2C (HTR2C, 5-hydroxytryptamine Receptor 2C, 5-HT-2C, 5-HT2C, 5-HTR2C, 5-hydroxytryptamine Receptor 1C, 5-HT-1C, 5-HT1C, HTR1C) (HRP)

Sign In for Pricing
View Details
Rat Transforming growth factor β1 receptor (TGF-β1R) ELISA Kit
RK14926 96 Tests

Rat Transforming growth factor β1 receptor (TGF-β1R) ELISA Kit

Sign In for Pricing
View Details