Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P38 gamma/MAPK12, Human (Active, sf9, GST)

The p38 gamma/MAPK12 protein is an important serine/threonine kinase in the MAP kinase pathway and can respond to extracellular stimuli such as pro-inflammatory cytokines or stress. p38 MAPK activates transcription factors such as ELK1 and ATF2, each of which phosphorylates approximately 200 to 300 substrates. p38 gamma/MAPK12 Protein, Human (Active, sf9, GST) is the recombinant human-derived p38 gamma/MAPK12 protein, expressed by Sf9 insect cells, with N-GST labeled tag.

Product Specifications

Product Name Alternative

P38 gamma/MAPK12 Protein, Human (Active, sf9, GST), Human, Sf9 insect cells

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/p38-gamma-mapk12-protein-human-active-sf9-gst.html

Smiles

SSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPL

Molecular Formula

6300 (Gene_ID) P53778-1 (S2-L367) (Accession)

Molecular Weight

Approximately 68.5 kDa

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tubulin inhibitor 49 (hydrobromide)
HY-169882A-01 5 mg

Tubulin inhibitor 49 (hydrobromide)

Sign In for Pricing
View Details
Tubulin inhibitor 49 (hydrobromide)
HY-169882A-02 10 mg

Tubulin inhibitor 49 (hydrobromide)

Sign In for Pricing
View Details
Tubulin inhibitor 49 (hydrobromide)
HY-169882A-03 25 mg

Tubulin inhibitor 49 (hydrobromide)

Sign In for Pricing
View Details
7-APB Hydrochloride
TRC-A790450-25MG 25 mg

7-APB Hydrochloride

Sign In for Pricing
View Details
ZFP37 Mouse Monoclonal Antibody [Clone ID: OTI5E3]
TA810210 100 µL

ZFP37 Mouse Monoclonal Antibody [Clone ID: OTI5E3]

Sign In for Pricing
View Details
EF-CBP2 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-9016R-BF555 100 µL

EF-CBP2 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details