Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P38 gamma/MAPK12, Human (Active, sf9, GST)

The p38 gamma/MAPK12 protein is an important serine/threonine kinase in the MAP kinase pathway and can respond to extracellular stimuli such as pro-inflammatory cytokines or stress. p38 MAPK activates transcription factors such as ELK1 and ATF2, each of which phosphorylates approximately 200 to 300 substrates. p38 gamma/MAPK12 Protein, Human (Active, sf9, GST) is the recombinant human-derived p38 gamma/MAPK12 protein, expressed by Sf9 insect cells, with N-GST labeled tag.

Product Specifications

Product Name Alternative

P38 gamma/MAPK12 Protein, Human (Active, sf9, GST), Human, Sf9 insect cells

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/p38-gamma-mapk12-protein-human-active-sf9-gst.html

Smiles

SSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPL

Molecular Formula

6300 (Gene_ID) P53778-1 (S2-L367) (Accession)

Molecular Weight

Approximately 68.5 kDa

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-RASSF6 Rabbit pAb
GB111806-100 100 μL

Anti-RASSF6 Rabbit pAb

Sign In for Pricing
View Details
MAYV-E2 Matched Antibody Pair Set [ABP-S-051057]
ABP-S-051057 5 Plates

MAYV-E2 Matched Antibody Pair Set [ABP-S-051057]

Sign In for Pricing
View Details
MRPS5 Protein Vector (Rat) (pPM-C-His)
PV283317 500 ng

MRPS5 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Rabbit anti-Escherichia fergusonii (strain 35469/DSM 13698/CDC 0568-73) NAGZ Polyclonal Antibody
MBS7176137 Inquire

Rabbit anti-Escherichia fergusonii (strain 35469/DSM 13698/CDC 0568-73) NAGZ Polyclonal Antibody

Sign In for Pricing
View Details
ROBO1 Antibody
C45975-01 50 μL

ROBO1 Antibody

Sign In for Pricing
View Details
ROBO1 Antibody
C45975-02 100 µL

ROBO1 Antibody

Sign In for Pricing
View Details