Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P38 gamma/MAPK12, Human (Active, sf9, GST)

The p38 gamma/MAPK12 protein is an important serine/threonine kinase in the MAP kinase pathway and can respond to extracellular stimuli such as pro-inflammatory cytokines or stress. p38 MAPK activates transcription factors such as ELK1 and ATF2, each of which phosphorylates approximately 200 to 300 substrates. p38 gamma/MAPK12 Protein, Human (Active, sf9, GST) is the recombinant human-derived p38 gamma/MAPK12 protein, expressed by Sf9 insect cells, with N-GST labeled tag.

Product Specifications

Product Name Alternative

P38 gamma/MAPK12 Protein, Human (Active, sf9, GST), Human, Sf9 insect cells

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/p38-gamma-mapk12-protein-human-active-sf9-gst.html

Smiles

SSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPL

Molecular Formula

6300 (Gene_ID) P53778-1 (S2-L367) (Accession)

Molecular Weight

Approximately 68.5 kDa

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD6 Protein (C-His, Mouse)
P523009 100 µg

CD6 Protein (C-His, Mouse)

Sign In for Pricing
View Details
Human CDKN1A siRNA
abx911314-01 15 nmol

Human CDKN1A siRNA

Sign In for Pricing
View Details
Human CDKN1A siRNA
abx911314-02 30 nmol

Human CDKN1A siRNA

Sign In for Pricing
View Details
Mouse Monoclonal B7-H6 Antibody (B7H6/4821) [Biotin]
NBP3-08339B 100 µL

Mouse Monoclonal B7-H6 Antibody (B7H6/4821) [Biotin]

Sign In for Pricing
View Details
Mouse Monoclonal Factor VIII A2 domain Antibody (2A5) [DyLight 350]
NB100-62559UV 0.1 mL

Mouse Monoclonal Factor VIII A2 domain Antibody (2A5) [DyLight 350]

Sign In for Pricing
View Details
Recombinant Chlamydia trachomatis Shikimate biosynthesis protein AroDE (aroE)
MBS1097856-01 0.02 mg (E-Coli)

Recombinant Chlamydia trachomatis Shikimate biosynthesis protein AroDE (aroE)

Sign In for Pricing
View Details