Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P38 gamma/MAPK12, Human (Active, sf9, GST)

The p38 gamma/MAPK12 protein is an important serine/threonine kinase in the MAP kinase pathway and can respond to extracellular stimuli such as pro-inflammatory cytokines or stress. p38 MAPK activates transcription factors such as ELK1 and ATF2, each of which phosphorylates approximately 200 to 300 substrates. p38 gamma/MAPK12 Protein, Human (Active, sf9, GST) is the recombinant human-derived p38 gamma/MAPK12 protein, expressed by Sf9 insect cells, with N-GST labeled tag.

Product Specifications

Product Name Alternative

P38 gamma/MAPK12 Protein, Human (Active, sf9, GST), Human, Sf9 insect cells

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/p38-gamma-mapk12-protein-human-active-sf9-gst.html

Smiles

SSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPL

Molecular Formula

6300 (Gene_ID) P53778-1 (S2-L367) (Accession)

Molecular Weight

Approximately 68.5 kDa

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ugt1a1 (NM_012683) Rat Untagged Clone
RN215066 10 µg

Ugt1a1 (NM_012683) Rat Untagged Clone

Sign In for Pricing
View Details
ALTA1 Antibody, Biotin conjugated
A50086-50UG 50 µg

ALTA1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
C9orf153 (NM_001276368) Human Untagged Clone
SC331047 10 µg

C9orf153 (NM_001276368) Human Untagged Clone

Sign In for Pricing
View Details
Lentiviral mouse Eepd1 shRNA (UAS) - Lentiviral mouse Eepd1 shRNA (UAS, iRFP) plasmid
GTR15149368 1 Vial

Lentiviral mouse Eepd1 shRNA (UAS) - Lentiviral mouse Eepd1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
LYPD6 sgRNA CRISPR Lentivector (Human) (Target 3)
K1247504 1.0 µg DNA

LYPD6 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
ATP Binding Cassette Subfamily G Member 4 (ABCG4) Antibody
abx026975-01 80 µL

ATP Binding Cassette Subfamily G Member 4 (ABCG4) Antibody

Sign In for Pricing
View Details