Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Carbonic Anhydrase 3, Human (His)

Carbonic Anhydrase 3 Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Carbonic anhydrase 3 (CA III) is a zinc metalloenzyme known to catalyze the reversible hydration of CO2 to HCO3-[1].

Product Specifications

Product Name Alternative

Carbonic Anhydrase 3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/carbonic-anhydrase-3-protein-human-his.html

Purity

97.0

Smiles

MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK

Molecular Formula

761 (Gene_ID) NP_005172.1 (A1-K260) (Accession)

Molecular Weight

28-30 kDa

References & Citations

[1]Brian P.Mahon, et al. Chapter 5 - Carbonic Anhydrase III. Carbonic Anhydrases as Biocatalysts, 2015, Pages 91-108.|[2]Han-Zhong Feng, et al. Carbonic Anhydrase III Is Expressed in Mouse Skeletal Muscles Independent of Fiber Type-Specific Myofilament Protein Isoforms and Plays a Role in Fatigue Resistance. Front Physiol. 2016 Dec 15;7:597.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MSBN 10mM * 1mL in DMSO
A22114-10mM-D 10 mM x 1mL in DMSO

MSBN 10mM * 1mL in DMSO

Ask
View Details
Itgb1 Rabbit Polyclonal Antibody
TA357469 100 µL

Itgb1 Rabbit Polyclonal Antibody

Ask
View Details
Sheep GTP-Binding Protein 1 (GTPBP1) ELISA Kit
MBS9921333-01 48 Well

Sheep GTP-Binding Protein 1 (GTPBP1) ELISA Kit

Ask
View Details
Sheep GTP-Binding Protein 1 (GTPBP1) ELISA Kit
MBS9921333-02 96 Well

Sheep GTP-Binding Protein 1 (GTPBP1) ELISA Kit

Ask
View Details
Sheep GTP-Binding Protein 1 (GTPBP1) ELISA Kit
MBS9921333-03 5x 96 Well

Sheep GTP-Binding Protein 1 (GTPBP1) ELISA Kit

Ask
View Details
Sheep GTP-Binding Protein 1 (GTPBP1) ELISA Kit
MBS9921333-04 10x 96 Well

Sheep GTP-Binding Protein 1 (GTPBP1) ELISA Kit

Ask
View Details