Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL2BP, Human (GST)

The ARL2BP protein cooperates with ARL2 to play a crucial role in the nuclear translocation, retention, and transcriptional activity of STAT3, highlighting its cellular involvement. As a potential effector of ARL2, ARL2BP forms a complex with ARL2, SLC25A6, and ARL3. ARL2BP Protein, Human (GST) is the recombinant human-derived ARL2BP protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

ARL2BP Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/arl2bp-protein-human-gst.html

Smiles

MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH

Molecular Formula

23568 (Gene_ID) Q9Y2Y0-1 (M1-H163) (Accession)

Molecular Weight

Approximately 45.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(-)-Riboflavin
TRC-R414995-500MG 500 mg

(-)-Riboflavin

Sign In for Pricing
View Details
PARK7 Antibody
KC-1476-01 50 μL

PARK7 Antibody

Sign In for Pricing
View Details
PARK7 Antibody
KC-1476-02 100 µL

PARK7 Antibody

Sign In for Pricing
View Details
PARK7 Antibody
KC-1476-03 1 mL

PARK7 Antibody

Sign In for Pricing
View Details
CFC1B (NM_001079530) Human Over-expression Lysate
LC421520 20 µg

CFC1B (NM_001079530) Human Over-expression Lysate

Sign In for Pricing
View Details
(R)-(-)-Carvone 4,4,6,6-d4
TRC-C184697-250MG 250 mg

(R)-(-)-Carvone 4,4,6,6-d4

Sign In for Pricing
View Details