Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAIR1, Mouse (HEK293, His)

The LAIR1 protein functions as an inhibitory receptor that negatively regulates NK cells, B cells, and T cells. LAIR1 is activated by tyrosine phosphorylation, recruits PTPN6 and PTPN11, and exerts downstream inhibitory effects. LAIR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived LAIR1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LAIR1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lair1-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

QEGSLPDITIFPNSSLMISQGTFVTVVCSYSDKHDLYNMVRLEKDGSTFMEKSTEPYKTEDEFEIGPVNETITGHYSCIYSKGITWSERSKTLELKVIKENVIQTPAPGPTSDTSWLKTY

Molecular Formula

52855 (Gene_ID) Q8BG84-1 (Q22-Y141) (Accession)

Molecular Weight

21-35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Major Vault Protein (MVP) (1032), CF740 conjugate, 0.1mg/mL
BNC740225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL
BNC040158-500 1x 500 µL

Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF594 conjugate, 0.1mg/mL
BNC941231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MMP9 (MMP9/2025R), CF405S conjugate, 0.1mg/mL
BNC042025-100 1x 100 µL

MMP9 (MMP9/2025R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), 0.2mg/mL
BNUB0449-100 1x 100 µL

CD104 (UM-A9), 0.2mg/mL

Sign In for Pricing
View Details
CD63 (Late Endosomes Marker) (LAMP3/2990R), CF640R conjugate, 0.1mg/mL
BNC402990-500 1x 500 µL

CD63 (Late Endosomes Marker) (LAMP3/2990R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details