LAIR1, Mouse (HEK293, His)
The LAIR1 protein functions as an inhibitory receptor that negatively regulates NK cells, B cells, and T cells. LAIR1 is activated by tyrosine phosphorylation, recruits PTPN6 and PTPN11, and exerts downstream inhibitory effects. LAIR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived LAIR1 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
LAIR1 Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/lair1-protein-mouse-hek-293-his.html
Purity
98.0
Smiles
QEGSLPDITIFPNSSLMISQGTFVTVVCSYSDKHDLYNMVRLEKDGSTFMEKSTEPYKTEDEFEIGPVNETITGHYSCIYSKGITWSERSKTLELKVIKENVIQTPAPGPTSDTSWLKTY
Molecular Formula
52855 (Gene_ID) Q8BG84-1 (Q22-Y141) (Accession)
Molecular Weight
21-35 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
FGF4, NT (Fibroblast Growth Factor-4, FGF-4, Heparin Secretory Transforming Protein 1, HSTF-1, HST-1, HST, Transforming Protein KS3, Heparin-binding Growth Factor 4, HBGF-4, HSTF1, KS3) (AP) discontinued
Fruit fly G9a Rabbit Polyclonal Antibody (Carrier-free)
Mouse DEP domain-containing protein 5 (DEPDC5) ELISA Kit
Mouse DEP domain-containing protein 5 (DEPDC5) ELISA Kit