Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IFN-beta, Human (His)

PDGF R beta protein is a receptor protein that binds to platelet-derived growth factor (PDGF) . It is expressed in a variety of cells, including fibroblasts and smooth muscle cells. Animal-Free IFN-beta Protein, Human (His) is the recombinant human-derived animal-FreeIFN-beta protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IFN-beta Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ifn-beta-protein-human-his.html

Purity

98.0

Smiles

MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN

Molecular Formula

3456 (Gene_ID) P01574/NP_002167.1 (M22-N187) (Accession)

Molecular Weight

Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Pyrimidine 5-Nucleotidase,P5-NT ELISA KIT
JOT-EK4089hu-01 96 Well

Human Pyrimidine 5-Nucleotidase,P5-NT ELISA KIT

Sign In for Pricing
View Details
Human Pyrimidine 5-Nucleotidase,P5-NT ELISA KIT
JOT-EK4089hu-02 48 Well

Human Pyrimidine 5-Nucleotidase,P5-NT ELISA KIT

Sign In for Pricing
View Details
RAD51L1 (RAD51-like 1 (S. cerevisiae), MGC34245, R51H2, RAD51B, REC2, hREC2) (AP) discontinued
250840-AP 100 µL

RAD51L1 (RAD51-like 1 (S. cerevisiae), MGC34245, R51H2, RAD51B, REC2, hREC2) (AP) discontinued

Sign In for Pricing
View Details
COQ3 Antibody - middle region : FITC (ARP48797_P050-FITC)
ARP48797_P050-FITC 100 µL

COQ3 Antibody - middle region : FITC (ARP48797_P050-FITC)

Sign In for Pricing
View Details
P2RY14 peptide
orb218301-01 1 mg

P2RY14 peptide

Sign In for Pricing
View Details
P2RY14 peptide
orb218301-02 5 mg

P2RY14 peptide

Sign In for Pricing
View Details