Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJC30, Human (His)

DNAJC30 is a neuron-enriched mitochondrial protein that plays a critical regulatory role in mitochondrial respiration. It binds to the ATP synthase complex and promotes ATP synthesis. DNAJC30 Protein, Human (His) is the recombinant human-derived DNAJC30 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

DNAJC30 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dnajc30-protein-human-his.html

Purity

98.0

Smiles

SQGDCSYSRTALYDLLGVPSTATQAQIKAAYYRQCFLYHPDRNSGSAEAAERFTRISQAYVVLGSATLRRKYDRGLLSDEDLRGPG

Molecular Formula

84277 (Gene_ID) Q96LL9 (S39-G124) (Accession)

Molecular Weight

Approximately 14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tas2r114 3'UTR GFP Stable Cell Line
TU170154 1.0 mL

Tas2r114 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Jurkat Cell Lysate
MBS656998-01 0.1 mL

Jurkat Cell Lysate

Sign In for Pricing
View Details
Jurkat Cell Lysate
MBS656998-02 5x 0.1 mL

Jurkat Cell Lysate

Sign In for Pricing
View Details
Xpress™ Human RING1 Over-expressing Stable Cell Line
ABC-X2648 1 Vial

Xpress™ Human RING1 Over-expressing Stable Cell Line

Sign In for Pricing
View Details
IFNE (Interferon, epsilon, IFN-E, IFNE1, IFNT1, MGC119018, MGC119020, PRO655) (AP) discontinued
247456-AP 100 µL

IFNE (Interferon, epsilon, IFN-E, IFNE1, IFNT1, MGC119018, MGC119020, PRO655) (AP) discontinued

Sign In for Pricing
View Details
STI1 Double Nickase Plasmid (h)
sc-403359-NIC 20 µg

STI1 Double Nickase Plasmid (h)

Sign In for Pricing
View Details