Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Delta-like 3/DLL3, Human (HEK293, His)

Delta-like protein 3/DLL3 stands out as a key regulator of neurogenesis and cell differentiation. As an inhibitor of primary neurogenesis, DLL3 plays a crucial role in guiding neurons along specific differentiation pathways. Delta-like protein 3/DLL3 Protein, Human (HEK293, His) is the recombinant human-derived Delta-like protein 3/DLL3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Delta-like protein 3/DLL3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dll3-protein-human-hek293-his.html

Purity

97.00

Smiles

AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL

Molecular Formula

10683 (Gene_ID) Q9NYJ7-1 (A27-L492) (Accession)

Molecular Weight

Approximately 52-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM177 Antibody, FITC conjugated
A36836-100UG 100 µg

TMEM177 Antibody, FITC conjugated

Sign In for Pricing
View Details
CCL24 Protein Vector (Human) (pPB-N-His)
PV008170 500 ng

CCL24 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
NHERF1/ EBP50 Blocking Peptide
3521RBP-50 50 μg

NHERF1/ EBP50 Blocking Peptide

Sign In for Pricing
View Details
mmu-miR-7018-3p miRNA Antagomir
MNM02798 2x 5.0 nmol

mmu-miR-7018-3p miRNA Antagomir

Sign In for Pricing
View Details
Human Ankyrin Repeat Domain Protein 12 (ANKRD12) ELISA Kit
EKN51173-01 48 Tests

Human Ankyrin Repeat Domain Protein 12 (ANKRD12) ELISA Kit

Sign In for Pricing
View Details
Human Ankyrin Repeat Domain Protein 12 (ANKRD12) ELISA Kit
EKN51173-02 96 Tests

Human Ankyrin Repeat Domain Protein 12 (ANKRD12) ELISA Kit

Sign In for Pricing
View Details