Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ciliary neurotrophic factor (CNTF)

Product Specifications

Product Name Alternative

CNTF

Abbreviation

Recombinant Human CNTF protein

Gene Name

CNTF

UniProt

P26441

Expression Region

1-200aa

Organism

Homo sapiens (Human)

Target Sequence

MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Neuroscience

Relevance

CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

26.8 kDa

References & Citations

"Expression and characterization of recombinant human ciliary neurotrophic factor from Escherichia coli." McDonald J.R., Ko C., Mismer D., Smith D.J., Collins F. Biochim. Biophys. Acta 1090:70-80 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Slc22a2 ELISA Kit
ELI-38734r 96 Tests

Rat Slc22a2 ELISA Kit

Sign In for Pricing
View Details
Bag PE Resealable 325 x 325mm
PB09 1000 / PCK

Bag PE Resealable 325 x 325mm

Sign In for Pricing
View Details
Donkey Nucleotide Exchange Factor SIL1 (SIL1) ELISA Kit
MBS9935390 Inquire

Donkey Nucleotide Exchange Factor SIL1 (SIL1) ELISA Kit

Sign In for Pricing
View Details
Charcot Leyden Crystal Protein (CLC) Porcine ELISA Kit
C4038 96 Tests

Charcot Leyden Crystal Protein (CLC) Porcine ELISA Kit

Sign In for Pricing
View Details
Cyclin D1; Ccnd1 Protein (N-His, Human)
P514661 100 µg

Cyclin D1; Ccnd1 Protein (N-His, Human)

Sign In for Pricing
View Details
AKOS B018304
BUP04161-01 1 mg

AKOS B018304

Sign In for Pricing
View Details