Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD59a, Mouse (HEK293, Fc)

CD59a Protein acts as a potent inhibitor of the complement membrane attack complex (MAC) by binding to C8 and/or C9 complements during MAC assembly. This interaction prevents the incorporation of multiple C9 copies, crucial for osmolytic pore formation. CD59a's regulatory role at the MAC assembly level safeguards cells, preventing uncontrolled osmolytic pore formation and protecting against complement-mediated damage. CD59a Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD59a protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD59a Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd59a-protein-mouse-hek293-fc.html

Purity

98.0

Smiles

LTCYHCFQPVVSSCNMNSTCSPDQDSCLYAVAGMQVYQRCWKQSDCHGEIIMDQLEETKLKFRCCQFNLCNK

Molecular Formula

12509 (Gene_ID) O55186/NP_001104530.1 (L24-K95) (Accession)

Molecular Weight

Approximately 42 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL
BNC470043-100 1x 100 µL

P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL
BNC470003-500 1x 500 µL

CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF640R conjugate, 0.1mg/mL
BNC400324-500 1x 500 µL

CD53 (161-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF555 conjugate, 0.1mg/mL
BNC550146-100 1x 100 µL

CD10 (CB-CALLA), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2038), CF568 conjugate, 0.1mg/mL
BNC682038-500 1x 500 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2038), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-DRB (HLA-DRB/1067), CF405S conjugate, 0.1mg/mL
BNC041067-100 1x 100 µL

HLA-DRB (HLA-DRB/1067), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details