Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free CNTF, Human (His)

CNTF is a pluripotent neurotrophic factor, belonging to the IL-6 cytokine family[1]. CNTF could protect retinal cone and rod photoreceptors[2]. CNTF has neuroprotective effects on a variety of central and also peripheral nervous system neurons[3]. Animal-Free CNTF Protein, Human (His) is produced by E. coli (M1-M200) with C-terminal His-tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free CNTF Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-cntf-protein-human-his.html

Purity

98.00

Smiles

MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM

Molecular Formula

1270 (Gene_ID) P26441 (M1-M200) (Accession)

Molecular Weight

Approximately 25 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Jones SA, et al. Recent insights into targeting the IL-6 cytokine family in inflammatory diseases and cancer. Nat Rev Immunol. 2018 Dec;18 (12) :773-789.|[2]Li S, et al. Ciliary neurotrophic factor (CNTF) protects retinal cone and rod photoreceptors by suppressing excessive formation of the visual pigments. J Biol Chem. 2018 Sep 28;293 (39) :15256-15268.|[3]Abbaszadeh HA, et al. Human ciliary neurotrophic factor-overexpressing stable bone marrow stromal cells in the treatment of a rat model of traumatic spinal cord injury. Cytotherapy. 2015 Jul;17 (7) :912-21.|[4]Zurn A D, et al. Combined effects of GDNF, BDNF, and CNTF on motoneuron differentiation in vitro[J]. Journal of neuroscience research, 1996, 44 (2) : 133-141.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Keratin (type II cytoskeletal 3 (KRT3) Rabbit ELISA Kit
E5065 96 Tests

Keratin (type II cytoskeletal 3 (KRT3) Rabbit ELISA Kit

Sign In for Pricing
View Details
PIC 315-TRI 315-B7527 Electrical & Equipment Safety Signs (No Adhesive)
252231 1 Card (1 Panel (s) x 1 Pack)

PIC 315-TRI 315-B7527 Electrical & Equipment Safety Signs (No Adhesive)

Sign In for Pricing
View Details
Anti-FoxO3a Rabbit Monoclonal Antibody
MBS179222-01 0.03 mL

Anti-FoxO3a Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-FoxO3a Rabbit Monoclonal Antibody
MBS179222-02 0.1 mL

Anti-FoxO3a Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-FoxO3a Rabbit Monoclonal Antibody
MBS179222-03 5x 0.1 mL

Anti-FoxO3a Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Rack (HxD) 7x3=21 boxes, 50mm, 389x425x140mm, Sliding shelf
TE24228 1 Piece

Rack (HxD) 7x3=21 boxes, 50mm, 389x425x140mm, Sliding shelf

Sign In for Pricing
View Details