ATP5MG, Bovine (Myc, His)
ATP5MG Protein, an essential part of mitochondrial membrane ATP synthase (Complex V), facilitates ATP generation from ADP using the proton gradient established by respiratory chain electron transport complexes. Positioned within the F (0) domain as a minor subunit alongside subunit a, ATP5MG collaborates with various subunits in the overall F-type ATPase complex, including CF (1) and CF (0), to ensure efficient ATP synthesis. ATP5MG Protein, Bovine (Myc, His) is the recombinant bovine-derived ATP5MG protein, expressed by E. coli , with N-His, C-Myc labeled tag.
Product Specifications
Product Name Alternative
ATP5MG Protein, Bovine (Myc, His), Bovine, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/atp5mg-protein-bovine-myc-his.html
Smiles
AEFVRNLAEKAPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPTAIQSLKKIINSAKTGSFKQLTVKEALLNGLVATEVWMWFYVGEIIGKRGIIGYDV
Molecular Formula
515696 (Gene_ID) Q28852 (A2-V103) (Accession)
Molecular Weight
Approximately 18.7 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog